Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate BPHYT_RS35465 BPHYT_RS35465 enoyl-CoA hydratase
Query= BRENDA::P77467 (262 letters) >FitnessBrowser__BFirm:BPHYT_RS35465 Length = 283 Score = 150 bits (380), Expect = 2e-41 Identities = 86/251 (34%), Positives = 133/251 (52%), Gaps = 3/251 (1%) Query: 13 VMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLNDRNVD 72 V T+TLNRPER N E +A+L + +Q+ ++ +++ GAG FC+G D++D Sbjct: 33 VATITLNRPERKNPLTFESYAELRDLFRQLTYATDVKAVVIHGAGDNFCSGGDVHDIIAP 92 Query: 73 PTG-PAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIVIAARSAK 131 P P+L + R LV+ + P+PVI AV+GV AGAGA LA+ D+ + +K Sbjct: 93 LIDLPMPEL-LLFTRMTGDLVKAMRHCPQPVIAAVDGVCAGAGAILAMSSDMRLGTARSK 151 Query: 132 FVMAFSKLGLIP-DCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQVVDDETL 190 FS++GL D G +LPR+ G+ RA L G S E+ H WG ++ + L Sbjct: 152 LAFLFSRVGLAGCDMGACTILPRIIGQGRAAELLFTGRSASGEEGHAWGFYNRLCEPAAL 211 Query: 191 ADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRSADYREGVSA 250 + A +LA L PTF G+ K+ ++ + ++D ++ E Q + + D+ SA Sbjct: 212 LEEAHKLAADLVAGPTFAHGITKKMLHQEWSMSIDEAIESEAQAQAICMSTRDFERAYSA 271 Query: 251 FLAKRSPQFTG 261 F AK P F G Sbjct: 272 FAAKSRPVFEG 282 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 283 Length adjustment: 25 Effective length of query: 237 Effective length of database: 258 Effective search space: 61146 Effective search space used: 61146 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory