GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaZ2 in Burkholderia phytofirmans PsJN

Align oxepin-CoA hydrolase (EC 3.3.2.12) (characterized)
to candidate BPHYT_RS13360 BPHYT_RS13360 aldehyde dehydrogenase

Query= BRENDA::P77455
         (681 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS13360 BPHYT_RS13360 aldehyde
           dehydrogenase
          Length = 531

 Score =  409 bits (1052), Expect = e-118
 Identities = 229/521 (43%), Positives = 317/521 (60%), Gaps = 14/521 (2%)

Query: 4   LASFLSGTWQSGRGRSRLIHHAISGEALWEVTSEGLDMAAARQFAIEKGAPALRAMTFIE 63
           L + ++G W +G G    +   ++G AL  V+SEGLD+A A  FA + G  ALRA+T+ +
Sbjct: 5   LKNHVAGQWIAGSGTGVTLTDPVTGVALVRVSSEGLDLAHAFGFARDTGGAALRALTYAQ 64

Query: 64  RAAMLKAVAKHLLSEKERFYALS-AQTGATRADSWVDIEGGIGTLFTYASLGSRELPDDT 122
           RAA L  + K L ++++ +YA++ A +G TR DS VDI+GGI TL  YA LG+  L D  
Sbjct: 65  RAARLADIVKLLQAKRDDYYAIATANSGTTRNDSAVDIDGGIFTLSYYAKLGA-SLGDVH 123

Query: 123 LWPEDELIPLSKEGGFAARHLLTSKSGVAVHINAFNFPCWGMLEKLAPTWLGGMPAIIKP 182
              + E + LSK+  F+ +H+LT   GVA+ INAFNFP WG+ EK AP  L G+P I+KP
Sbjct: 124 ALRDGESVSLSKDQSFSVQHVLTPTRGVALFINAFNFPSWGLWEKAAPALLSGVPVIVKP 183

Query: 183 ATATAQLTQAMVKSIVDSGLVPEGAISLICGSAGDLLDHLDSQDVVTFTGSAATGQMLRV 242
           ATATA LTQ MV  +VD+G++P GA+S+ICGS+  LLD + S DVV+FTGSA T   LR 
Sbjct: 184 ATATAWLTQRMVADVVDAGILPPGALSVICGSSAGLLDQIQSFDVVSFTGSAQTAATLRA 243

Query: 243 QPNIVAKSIPFTMEADSLNCCVLGEDVTPDQPEFALFIREVVREMTTKAGQKCTAIRRII 302
            P  V +     +EADSLN  +L  D  P  P F LFI+EVVREMT K+GQKCTAIRR  
Sbjct: 244 HPAFVQRGARLNVEADSLNSAILCADAAPGTPAFDLFIKEVVREMTVKSGQKCTAIRRAF 303

Query: 303 VPQALVNAVSDALVARLQKVVVGDPAQEGVKMGALVNAEQRADVQEKVNILLAAGCEIRL 362
           VP+  + AV +AL A+L K+ VGDP  + V+MG+LV+ EQ  +V   +  L         
Sbjct: 304 VPEGALEAVLEALNAKLAKITVGDPRNDTVRMGSLVSREQYENVLAGIAALREEAVLAFD 363

Query: 363 GGQADL----SAAGAFFPPTLLYCPQPDETPAVHATEAFGPVATLMPAQ--------NQR 410
           G    L    S   A   P L     PD    +H  E FGPVA++ P +         + 
Sbjct: 364 GSAVPLIDADSNIAACIAPHLFVVNDPDNATLLHDVEVFGPVASVAPYRVATDAATLPEA 423

Query: 411 HALQLACAGGGSLAGTLVTADPQIARQFIADAARTHGRIQILNEESAKESTGHGSPLPQL 470
           HA+ LA  G GSL  ++ + D     +   + A +HGR+  ++    +  TGHG+ +P  
Sbjct: 424 HAVALARRGQGSLVASIYSNDEAHLGRLALELADSHGRVHAISPSVQQSQTGHGNVMPMS 483

Query: 471 VHGGPGRAGGGEELGGLRAVKHYMQRTAVQGSPTMLAAISK 511
           +HGGPGRAGGGEELGGLRA+  Y +R+A+Q +   + ++++
Sbjct: 484 LHGGPGRAGGGEELGGLRALGFYHRRSAIQAASAAIGSLTQ 524


Lambda     K      H
   0.319    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 803
Number of extensions: 36
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 681
Length of database: 531
Length adjustment: 37
Effective length of query: 644
Effective length of database: 494
Effective search space:   318136
Effective search space used:   318136
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory