GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aacS in Burkholderia phytofirmans PsJN

Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate BPHYT_RS17295 BPHYT_RS17295 long-chain fatty acid--CoA ligase

Query= reanno::acidovorax_3H11:Ac3H11_3009
         (578 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS17295 BPHYT_RS17295 long-chain
           fatty acid--CoA ligase
          Length = 557

 Score =  228 bits (581), Expect = 5e-64
 Identities = 168/523 (32%), Positives = 252/523 (48%), Gaps = 20/523 (3%)

Query: 51  VHQGRRYTYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNAEWVLMQLATAQVGLVLVN 110
           V  G+  +Y +L   + +LA+     GL  G R+ I   N  ++ +   A  + G V+VN
Sbjct: 43  VCMGKEISYGELDALSRKLAAWFQSKGLARGARIAIMMPNVLQYPVAIAAILRAGYVVVN 102

Query: 111 INPAYRTAEVEYALNKVGCKLLVSMARFKTSDYLGMLRELAPEWQGQQPGHLQAAKLPQL 170
           +NP Y   E+E+ L   G + ++ +  F  +    +             G L   K   +
Sbjct: 103 VNPLYTPRELEHQLKDSGAEAIILLENFAVTLQAIVRNTSIKHVVVAAMGDLMGIKGTLV 162

Query: 171 KTVVWIDDEAGQGADEPGLLRFTELIARGNAADPRLAQVAAGLQATDPINIQFTSGTTGF 230
             VV    +       PG ++F   IA G  A      V  G +  D   +Q+T GTTG 
Sbjct: 163 NFVVRKVKKMVPAWSLPGHVKFNTAIAEG--ARQNFKPVQQGPE--DVAFLQYTGGTTGV 218

Query: 231 PKGATLTHRNILNNGFFIGECMKLTPADR-------LCIPVPLYHCFGM-VLGNLACFTH 282
            KGATL HRN++ N       +    A+R         + +PLYH F + V G L   T 
Sbjct: 219 AKGATLLHRNLIANVLQSEIWLDPVRANRKDIDQFVTVVALPLYHVFALTVCGLLTIRTG 278

Query: 283 GATIVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIAELDHPRFAEFNLSTLRTGIMAGS 342
           G  ++ PN    P  +++ ++    T +  V T++ A L+ P F + + S L      G 
Sbjct: 279 GLGVLIPNPRDIP-GMIKALEGYPITTIPAVNTLYNALLNSPDFHKLDFSKLIAANGGGM 337

Query: 343 PCPTEVMKRVVEQMNLREITIAYGMTETSP-VSCQSSTDTPLSKRVSTVGQVQPHLEVKI 401
                V KR  EQ +   I   YG++ETSP V+C   T T  S    T+G   P  E+ I
Sbjct: 338 AVQEAVAKRWYEQTHT-PIIEGYGLSETSPCVTCNPVTVTEYS---GTIGLPLPSTEISI 393

Query: 402 VDPDTGAVVPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDEGGWMHTGDLATMDAEGYVN 461
            D D G  VP+GQ GE C +G  VM GYW    +T + +   G+  +GD+  M+  G+V 
Sbjct: 394 RD-DEGNEVPLGQPGEICIRGPQVMAGYWNRPDETAKVMTADGFFKSGDVGLMNDGGFVK 452

Query: 462 IVGRIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPDQKYGEELCAWIIAKPGTQP 521
           IV R KDM++  G N+YP EIE+ + + P V +V  VGVPDQ  GE +  +++ K     
Sbjct: 453 IVDRKKDMILVSGFNVYPNEIEDVVAKLPGVFEVAAVGVPDQHSGEAVKLFVVKKDQAL- 511

Query: 522 TEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKIRD 564
           T+ DI A+CK Q+  YK P+ + F T  P +  GKI + ++RD
Sbjct: 512 TDADIFAYCKQQLTGYKRPKIVEFRTELPKSNVGKILRRELRD 554


Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 741
Number of extensions: 40
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 578
Length of database: 557
Length adjustment: 36
Effective length of query: 542
Effective length of database: 521
Effective search space:   282382
Effective search space used:   282382
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory