GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bamH in Burkholderia phytofirmans PsJN

Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate BPHYT_RS14990 BPHYT_RS14990 formate dehydrogenase subunit beta

Query= uniprot:Q39TW5
         (635 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS14990 BPHYT_RS14990 formate
           dehydrogenase subunit beta
          Length = 520

 Score =  321 bits (822), Expect = 6e-92
 Identities = 192/517 (37%), Positives = 280/517 (54%), Gaps = 16/517 (3%)

Query: 28  ISVCAGAGCLASGAAEVIAAFKTELEFHGLTTEVNTKGTGCPGFCERGPIVMIYP-EG-I 85
           I V   +  LA GA  +  A + E    GL  E+   G+   G     P+V +   EG I
Sbjct: 4   IYVPRDSSALALGADALAQAIENEAARRGLAIELVRNGSR--GLLWLEPLVEVQTSEGRI 61

Query: 86  CYLKVKPEDVPEIVSHTIKEKKVVDRLLYEDPATGTRALRESDIPFYKNQQRNILSENLR 145
            Y  ++  DV  +           D    E  A   R      IP+ K QQR   +    
Sbjct: 62  GYANIEAGDVSALF----------DAGFLEGGAHANRVGVVDAIPYLKKQQRLTFARIGI 111

Query: 146 LDSKSMDDYLAIGGYSALSKVLFQMTPEDVMGEIKKSNLRGRGGGGFPAWRKWEESRNAP 205
            D  S+DDY+A GG   L   L Q   +     + +S LRGRGG  FPA  KW   R A 
Sbjct: 112 TDPLSIDDYVAHGGLEGLRNAL-QTDGDAACEALIESGLRGRGGAAFPAGIKWRTVRGAK 170

Query: 206 DPIKYVIVNADEGDPGAFMDRALIEGNPHSILEGLIIGAYAVGAHEGFIYVRQEYPLAVE 265
              KY++ NADEGD G F DR ++E +P+ ++EG+II     GA  G IYVR EYP ++ 
Sbjct: 171 AAQKYIVCNADEGDSGTFSDRLVMESDPYVLIEGMIIAGVVTGATVGHIYVRSEYPHSIA 230

Query: 266 NINLAIRQASERGFVGKDILGSGFDFTVKVHMGAGAFVCGESSALMTALEGRAGEPRPKY 325
            +  AI +A   G++G  +LGS   F + V  GAGA+VCGE +AL+ +LEG+ G  R K 
Sbjct: 231 TLEAAIAKARAAGWLGDRVLGSAHRFELFVAKGAGAYVCGEETALLESLEGKRGIVRAKP 290

Query: 326 IHTAVKGVWDHPSVLNNVETWANVTQIITKGADWFTSYGTAGSTGTKIFSLVGKITNTGL 385
              A+ G++  P+V+NNV T A V  I  +GA ++  +G   S GT  F L G +   GL
Sbjct: 291 PVPALVGLFGQPTVINNVITLATVPIIFARGAAFYKDFGMGRSRGTLPFQLAGNVKQGGL 350

Query: 386 VEVPMGVTLRDIITKVGGGIPGGKKFKAVQTGGPSGGCIPEAMLDLPVDFDELTKAGSMM 445
           VE+  GVTLR+++   GGG   G+  +AVQ GGP G  +PE+  D+P+D++     G+++
Sbjct: 351 VELAFGVTLRELLYDYGGGTASGRPARAVQVGGPLGTYLPESQWDIPMDYEAYAAVGAVV 410

Query: 446 GSGGMIVMDEDTCMVDIARYFIDFLKDESCGKCTPCREGIRQMLAVLTRITVGKGKEGDI 505
           G GG++V D+ + + ++A+Y + F   ESCGKCTPCR G  + + V+ RI  G      +
Sbjct: 411 GHGGLVVHDDTSNLAELAQYAMHFCALESCGKCTPCRIGSTRGVEVIGRIRNGDTSTRQV 470

Query: 506 ELLEELAES-TGAALCALGKSAPNPVLSTIRYFRDEY 541
           +LL +L ++    +LCA+G   P PVLS + +F +++
Sbjct: 471 QLLRDLCDTMVSGSLCAMGGMTPFPVLSALDHFPEDF 507


Lambda     K      H
   0.319    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 818
Number of extensions: 47
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 635
Length of database: 520
Length adjustment: 36
Effective length of query: 599
Effective length of database: 484
Effective search space:   289916
Effective search space used:   289916
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory