Align indolepyruvate ferredoxin oxidoreductase (subunit 1/2) (EC 1.2.7.8) (characterized)
to candidate BPHYT_RS02015 BPHYT_RS02015 MFS transporter
Query= BRENDA::Q6LZB5 (188 letters) >FitnessBrowser__BFirm:BPHYT_RS02015 Length = 1195 Score = 50.8 bits (120), Expect = 9e-11 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 8/110 (7%) Query: 2 NIVIAAVGGQGAVLASKILGTLAQNLGKDVKVSEVHGMSQRGGSVVAYVKFG---EKVYS 58 +I++ VGG G V ++ A GK V + G +Q+GGSV+++V+F E + Sbjct: 732 DILVTGVGGTGVVTVGALISMAAHLEGKSASVLDFMGFAQKGGSVLSFVRFAARDEWLNQ 791 Query: 59 PVVEKGTADIVLAFEMLEGARYVDYLKE----NGKLVVNTQKIDPMPVIT 104 ++ AD++LA +M+ GA D L+ ++VVNT I +T Sbjct: 792 VRIDTQQADVLLACDMVVGAS-ADALQTVRHGRTRIVVNTHAIPNATFVT 840 Lambda K H 0.315 0.135 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 24 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 188 Length of database: 1195 Length adjustment: 33 Effective length of query: 155 Effective length of database: 1162 Effective search space: 180110 Effective search space used: 180110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory