Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate BPHYT_RS32970 BPHYT_RS32970 glutathione S-transferase
Query= reanno::acidovorax_3H11:Ac3H11_2306 (222 letters) >FitnessBrowser__BFirm:BPHYT_RS32970 Length = 210 Score = 53.9 bits (128), Expect = 2e-12 Identities = 38/105 (36%), Positives = 51/105 (48%), Gaps = 1/105 (0%) Query: 7 FRSSASFRVRIALQIKGLAYDYLPVHLVKGEHKAPEYASRIGDALVPTLVTDGGTALSQS 66 F S + V +ALQ K L ++ V L + YA++ VPTL T G ALS+S Sbjct: 14 FASPYAMSVFVALQEKQLPFELFAVDLGTDANHEESYAAKSLTQRVPTL-THGAFALSES 72 Query: 67 MAIIEYLDETHPTPALLPATPLARARVRALAQMVACEIHPINNLR 111 AI EYLD+T + P RAR R L + ++ PI R Sbjct: 73 SAITEYLDDTFAETLVYPQDRHLRARARQLQAWLRSDLMPIRQER 117 Lambda K H 0.323 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 88 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 210 Length adjustment: 22 Effective length of query: 200 Effective length of database: 188 Effective search space: 37600 Effective search space used: 37600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory