GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaA in Burkholderia phytofirmans PsJN

Align ring 1,2-phenylacetyl-CoA epoxidase PaaA subunit (EC 1.14.13.149) (characterized)
to candidate BPHYT_RS18250 BPHYT_RS18250 phenylacetate-CoA oxygenase subunit PaaA

Query= metacyc::MONOMER-15947
         (330 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS18250 BPHYT_RS18250
           phenylacetate-CoA oxygenase subunit PaaA
          Length = 332

 Score =  449 bits (1156), Expect = e-131
 Identities = 210/305 (68%), Positives = 256/305 (83%), Gaps = 1/305 (0%)

Query: 22  EERAFQERIDAEIKIEAKNWMPDAYRQTLIRQISQHAHSEIVGMLPEGNWVTRAPTLKRK 81
           E+  F   + A+ KIEA++WMP+AYR+TL+RQISQHAHSEIVGMLPEGNW+TRAP+LKRK
Sbjct: 23  EQVQFDAVMAADGKIEAQDWMPEAYRKTLVRQISQHAHSEIVGMLPEGNWITRAPSLKRK 82

Query: 82  LQLMAKIQDEAGHGLYLYSAMETLGADRDEEIAKLHSGKAKYSSIFNYPTLNWADMGAVG 141
             L+AK+QDEAGHGLYLYSA ETLG  RD+ IA LHSGKAKYSSIFNYPT  WAD+G +G
Sbjct: 83  AILLAKVQDEAGHGLYLYSAAETLGVSRDQLIAALHSGKAKYSSIFNYPTPTWADVGVIG 142

Query: 142 WLVDGAAIVNQVVLQRTSYGPYSRAMIRICKEESFHQRQGYEILLTMMRHGTQAQKDMVQ 201
           WLVDGAAI+NQ+ L R +YGPY+RAMIRICKEESFHQRQG++ L++MM  GT+AQ+++VQ
Sbjct: 143 WLVDGAAIMNQIPLCRCTYGPYARAMIRICKEESFHQRQGFDALMSMMA-GTEAQRELVQ 201

Query: 202 DAINRLWWPALMMFGPSDEHSPNSAQSMAWKIKRQSNDELRQRFIDQTVPQLELLGCTAP 261
            A+NR WWP LMMFGPSD+ S +S QS  W IKR SND+LRQ+F+D TV Q ++LG T P
Sbjct: 202 QAVNRWWWPVLMMFGPSDKDSIHSNQSSKWGIKRISNDDLRQKFVDATVDQAKVLGVTLP 261

Query: 262 DPELKWNEERGHYDFGAIDWSEFYEVLKGNGPCNAERIATRRNAIDNGAWVREAAVAHAR 321
           DP+LKWNE RGH+D+G IDW EF+ V+ G+GPCN ER+ATR  A D+GAWVREAA+AHA 
Sbjct: 262 DPDLKWNEARGHHDYGDIDWEEFWRVVNGDGPCNRERLATRVKAHDDGAWVREAALAHAE 321

Query: 322 KQQHK 326
           KQ+ +
Sbjct: 322 KQRQR 326


Lambda     K      H
   0.318    0.131    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 432
Number of extensions: 12
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 330
Length of database: 332
Length adjustment: 28
Effective length of query: 302
Effective length of database: 304
Effective search space:    91808
Effective search space used:    91808
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory