Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate BPHYT_RS09565 BPHYT_RS09565 acetyl-CoA acetyltransferase
Query= metacyc::MONOMER-20679 (395 letters) >FitnessBrowser__BFirm:BPHYT_RS09565 Length = 392 Score = 469 bits (1207), Expect = e-137 Identities = 244/394 (61%), Positives = 297/394 (75%), Gaps = 2/394 (0%) Query: 1 MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQ 60 MT+AVIVSTART + K++RG N T GATL GH + AV+RA +DP VEDV+MG A + Sbjct: 1 MTDAVIVSTARTGLAKSWRGGFNMTHGATLGGHVTQAAVERAKLDPARVEDVIMGCANPE 60 Query: 61 GATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESI 120 GATG NIAR+ LRAGLPV+ G T++R C+SGLQ IALAA+ V+ ++ V GG ESI Sbjct: 61 GATGMNIARQIALRAGLPVSVPGMTVNRFCSSGLQTIALAAQRVIAGEGDVFVAGGVESI 120 Query: 121 SLVQNDKMNTFHAVDPALEAIKGDVYMAMLDTAETVAKRYGISRERQDEYSLESQRRTAA 180 S VQN+ MN + L K ++Y +ML TAE VAKRY IS+ERQDEY SQ+R AA Sbjct: 121 SCVQNE-MNHHMLTEGWLSQNKPEIYWSMLQTAENVAKRYSISKERQDEYGARSQQRAAA 179 Query: 181 AQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLAGLKAVRGEG 240 A + GKF DEI P++ GV DKA+G + K++T+S DEG R +TT EG++ ++ G Sbjct: 180 ALEAGKFKDEIVPLTVLAGVADKASGRLFTKEVTVSGDEGIRADTTLEGVSKIRTALPGG 239 Query: 241 FTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCEPDEMGIGPVFAVPR 300 ITAGNASQ SDGASA V+M+ K A +GL+PLGIFRG GCEPDEMGIGPVFAVP+ Sbjct: 240 -VITAGNASQFSDGASACVVMNAKVAEREGLQPLGIFRGFAVAGCEPDEMGIGPVFAVPK 298 Query: 301 LLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISVGHPYGMSGARLA 360 LLK+ GL V+DI LWELNEAFAVQVLYC DKLGI ++LNVNGGAI+VGHPYG+SGARL Sbjct: 299 LLKQAGLKVEDIDLWELNEAFAVQVLYCADKLGIPQDRLNVNGGAIAVGHPYGVSGARLT 358 Query: 361 GHALIEGRRRKAKYAVVTMCVGGGMGSAGLFEIV 394 GHALIEG+RR AK VVTMC+GGG G+AGLFE+V Sbjct: 359 GHALIEGKRRGAKLVVVTMCIGGGQGAAGLFEVV 392 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 511 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 392 Length adjustment: 31 Effective length of query: 364 Effective length of database: 361 Effective search space: 131404 Effective search space used: 131404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory