GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pimF in Burkholderia phytofirmans PsJN

Align 6-carboxyhex-2-enoyl-CoA hydratase (characterized)
to candidate BPHYT_RS13545 BPHYT_RS13545 3-hydroxyacyl-CoA dehydrogenase

Query= metacyc::MONOMER-20678
         (699 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS13545 BPHYT_RS13545
           3-hydroxyacyl-CoA dehydrogenase
          Length = 706

 Score =  648 bits (1672), Expect = 0.0
 Identities = 349/706 (49%), Positives = 468/706 (66%), Gaps = 22/706 (3%)

Query: 2   SEVVTRATQDQVAIVTVDSPPVNALSAAVRRGILENVNAAVADPAVQAIVLVCAGRTFIA 61
           ++VV+R  + +V +VT+D  PVNALSA VRRG+L  + AA AD AV+A+++V AGR FIA
Sbjct: 7   ADVVSRELRGKVLLVTIDHAPVNALSADVRRGLLAAIEAADADKAVEAVLIVGAGRNFIA 66

Query: 62  GADITEFGKPPQPPALNDVIAALENSPKPTIAAIHGTALGGGLEVALGCHFRVAVKEAKL 121
           GADI EFGKPP PP+L DV   +E   KP +AAIHG ALGGGLEVAL  H+R+AV  AKL
Sbjct: 67  GADIREFGKPPVPPSLPDVCNRIEACTKPVVAAIHGAALGGGLEVALAAHYRIAVDGAKL 126

Query: 122 GLPEVKLGLLPGAGGTQRLPRAVGPELAVQMIVGGSPIGAAEALKHGLVEEV--VENLVA 179
           GLPEV+LGLLPGAGGTQR PR +G + A+ +I+ G    A EAL  GL++ +   ++++A
Sbjct: 127 GLPEVQLGLLPGAGGTQRTPRLIGAQAALDLILSGRHASAKEALAFGLIDRLGSSDDILA 186

Query: 180 GAVAFAKKVLAEKRPLRRLRDDDSKLAAAKADRSIFTNAVAAM----TKKARGLEAPFAC 235
             +A+  ++LA   P+RR RD     AAA +DR+    AVA       KK+RGL +P   
Sbjct: 187 EGLAYVHELLAAHAPVRRTRD-----AAALSDRAASLAAVATARAETAKKSRGLFSPLKI 241

Query: 236 ADAIGAAIDLPFEEGLKKEREGFMKLVVSDQSKAQRYAFFAEREAAKVDGVPDGTKPRPV 295
            DA+ AAI+ PF+EGL+ ER+ F++ + S Q     +AFFAERE  K        KPR +
Sbjct: 242 VDAVEAAIEQPFDEGLRVERKLFLECIDSPQRAGLIHAFFAEREVLKAPETR-AAKPRTL 300

Query: 296 SRVAIIGAGTMGGGIAMSFANAGIPVTLIETGEEQLKRGLGIMQKNWEATAARGGLPPDA 355
           + + ++G GTMG GIA++  +AG+PVT+IE  +  L RG   ++K ++   A+G L  + 
Sbjct: 301 NTIGVVGGGTMGAGIAVAVLDAGLPVTMIERDDASLARGRAHIEKVYDGLIAKGRLSAEK 360

Query: 356 PAKRMALITGLVGLENVKDADLIIEAVFETMAVKKEVFTAVDAHAKPGAVLASNTSYLSI 415
            A  M+  +G    + +  ADL+IEAVFE +AVK+ VF  +D   K GAVLA+NTSYL I
Sbjct: 361 KAALMSRWSGSTSYDALAGADLVIEAVFEDLAVKQAVFAELDRVCKAGAVLATNTSYLDI 420

Query: 416 DEIAATTKRPQDVLGMHFFSPANVMKLCEIVRGAKTAPDALLTAVSIAKKIAKVPVVVGV 475
           D +A++  RP DV+G+HFFSPAN+MKL E+V   + + D + TA  +AKK+ K PV  GV
Sbjct: 421 DALASSVSRPADVIGLHFFSPANIMKLLEVVVPKQVSADVVATAFELAKKLRKTPVRAGV 480

Query: 476 CDGFVGNRMLAARSKQSEKLLFEGALPQQVDAVVTKFGMPMGPFAMGDLAGLDIGWRSRK 535
           CDGF+GNR+LA     ++ ++ +GA P Q+DA V  FG PMGPF + DLAG DIGW +RK
Sbjct: 481 CDGFIGNRVLAVYRSAADAMMEDGASPYQIDAAVRAFGFPMGPFQVVDLAGGDIGWAARK 540

Query: 536 DRGIKS-------EIADALCEAGRFGQKTGKGYYKYEQGSRAPMPDPEVETLINDTLAKL 588
            R           +IAD LCE G FGQK+G+G+Y Y +GSR+  PDPEVE +I+   A+ 
Sbjct: 541 RRAATRNPAARYVQIADRLCERGWFGQKSGRGFYLYPEGSRSGTPDPEVEAIIDAERARA 600

Query: 589 GLKRRDITDEEILERMVYPMINEGARILEEKIAARPSDIDVVWLYGYGWPIYRGGPMHYA 648
           G+  R  TDEEI+ R +  MINEGA ++ E+IA RP D+DV +LYGYG+P YRGGPM YA
Sbjct: 601 GITPRSFTDEEIIRRYMAAMINEGANVVHERIALRPLDVDVTFLYGYGFPRYRGGPMKYA 660

Query: 649 DSVGLKHIAERLSAYAKATNDPSL-EPAPLLARLAAEGKTFASLTQ 693
           D VGL  I   +  +AK   DP   +P+PLL  L   G  FASL Q
Sbjct: 661 DMVGLPKILADIREFAK--EDPLFWKPSPLLIELVERGADFASLNQ 704


Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1187
Number of extensions: 55
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 699
Length of database: 706
Length adjustment: 39
Effective length of query: 660
Effective length of database: 667
Effective search space:   440220
Effective search space used:   440220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory