Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate BPHYT_RS04435 BPHYT_RS04435 ABC transporter
Query= uniprot:G8ALI9 (505 letters) >FitnessBrowser__BFirm:BPHYT_RS04435 Length = 646 Score = 148 bits (373), Expect = 7e-40 Identities = 86/281 (30%), Positives = 150/281 (53%), Gaps = 25/281 (8%) Query: 179 LLTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLAHYFGFSFWVCLPLAGFLAAM 238 ++ Y +L +GL+IVVG G + LG+ + VGAY+ +L G F V PLA + A Sbjct: 35 IMIYAILLFGLDIVVGYTGQVSLGHAGLFGVGAYTAGVLFFKLGMPFIVTAPLAILITAA 94 Query: 239 SGVLLGFPVLRLRGDYFAIVTLGFGEIIRIILINWYQFTGGPNGISGIPRPSFFGIADFT 298 G +L P LR+ G Y A+VTL FG I++I++ T GP G+ IP+PS G Sbjct: 95 FGAILALPALRVSGPYLAMVTLAFGTILQILINEMDFLTNGPMGVK-IPKPSLAG----- 148 Query: 299 RTPAEGTAAFHEMFGLEFSPLHRIIFLYYLILVLALVVNLFTMRVRKLPLGRAWEALRED 358 P++ + + Y+L+ L + + RV + LGRA+EALR+ Sbjct: 149 ------------------RPMNEVEY-YWLVAALLVASLIVVHRVLRSHLGRAFEALRDS 189 Query: 359 DIACASLGINRTNMKLAAFAIAAMFGGFAGSFFATRQGFISPESFTFIESAIILAIVVLG 418 IA +G++ K+ AF I+A F G AG ++ + +ISP ++ F + + L +++G Sbjct: 190 PIASDCMGVSVYRYKVYAFVISAGFAGLAGCLYSYSEQYISPNTYNFELTILFLLAIIMG 249 Query: 419 GMGSQIGVVVAAFLVIGLPEAFRELADYRMLAFGMGMVLIM 459 G ++ G ++ + +++ LP+ ++ +R +A + V+++ Sbjct: 250 GRKTRTGALLGSAIIVLLPKLLDDIDMFRTVASVLAAVVVI 290 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 680 Number of extensions: 41 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 505 Length of database: 646 Length adjustment: 36 Effective length of query: 469 Effective length of database: 610 Effective search space: 286090 Effective search space used: 286090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory