Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate BPHYT_RS31715 BPHYT_RS31715 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:A0A165KTD4 (375 letters) >FitnessBrowser__BFirm:BPHYT_RS31715 Length = 380 Score = 342 bits (876), Expect = 1e-98 Identities = 172/368 (46%), Positives = 242/368 (65%), Gaps = 5/368 (1%) Query: 10 VAAIAAAAGVASAQEQ--VVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGVTIGGK 67 VAA++AA A A + V+KIG AP +GA A+ GK+NENGAR+A+E++N +G+ I GK Sbjct: 11 VAALSAACNAAFAADDITVIKIGSAAPTTGAIANLGKENENGARLAVEDVNRRGLVINGK 70 Query: 68 KIKFELVAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGA 127 KIK EL A DD ADP+QGT AQ+L D V VVGHLNSG +I AS++Y+D I ++ Sbjct: 71 KIKLELDAVDDQADPRQGTQVAQRLVDDGVVAVVGHLNSGVSIAASRIYHDAQILQISPD 130 Query: 128 ATNPNLTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGVADVFKK 187 +TNP T+ G+ TT+R++A D LA YA++TLK K VAI+DD TAYGQG+AD F Sbjct: 131 STNPKFTQQGFNTTYRLVATDAQQSPVLAHYALETLKAKKVAIVDDSTAYGQGLADQFSS 190 Query: 188 TATAKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQMEQLGMGN 247 + G VV + T DK DF ++T IK ++PD IFYGGMD GP ++Q+ QLG+ N Sbjct: 191 AVKSGGATVVAREATNDKTIDFKGVITKIKGQSPDVIFYGGMDATAGPFIKQVAQLGL-N 249 Query: 248 VKYFGGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKYDAKYPNQFQVY 307 K GGDG C+ E+ LA A + ++C+ G L++M G A++ +Y ++ Q+Y Sbjct: 250 AKVLGGDGTCSDEVIALAGPA--VDRLVCSIAGLPLSRMKAGPAFEKEYQQRFGMPVQIY 307 Query: 308 SPYTYDATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTSTIAFEPNGEMKNPAITLYVY 367 +PY YDA +IVDAMK++ S D + + ++G+T I F+ G++++P +TLY Y Sbjct: 308 APYAYDAVMVIVDAMKKSGSTDHAKILAAASATDYQGLTGQIQFDDKGDVRSPRLTLYGY 367 Query: 368 KDGKKTPL 375 KDGKKT L Sbjct: 368 KDGKKTLL 375 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 380 Length adjustment: 30 Effective length of query: 345 Effective length of database: 350 Effective search space: 120750 Effective search space used: 120750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory