Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate BPHYT_RS31940 BPHYT_RS31940 ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__BFirm:BPHYT_RS31940 Length = 294 Score = 141 bits (356), Expect = 2e-38 Identities = 89/303 (29%), Positives = 171/303 (56%), Gaps = 14/303 (4%) Query: 1 MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQV 60 M + +Q +N L GS+Y L ALG T+++GV+ ++NFAHG +GA++ L+ +++ Sbjct: 1 MALIVQLALNTLQAGSVYVLFALGLTLIFGVMGVVNFAHGQFFTLGALLTSVLVPALRE- 59 Query: 61 APGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRP-LRNAPRLAPLITAIGVSILLQTLA 119 A G+ + A +I + ++ L+ + +R LR+ + I ++G+ + + + Sbjct: 60 AFGMGVALAFTFASAISIVAVLALAALVYQFGFRHYLRDT--VGSFILSVGLLLFFEGVF 117 Query: 120 MMIWGRSPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRA 179 + ++G P P + P + + + GA I ++++ A+AV+ V L L++ T+ GRA+RA Sbjct: 118 LWVFGGVPRVVPNIAPGE-LRVFGAAIELQRLVVFAIAVIITVLLYLMLAFTRFGRAIRA 176 Query: 180 TAENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAA 239 TA++ A L G+ + ++ F +G+ L+A++G + A + A+G +K F Sbjct: 177 TADDAGAATLQGIRDKRTLLYGFMVGSFLSAVSGCL-TAPIAVITPAVGNDYLIKGFITI 235 Query: 240 VLGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSG 299 ++GG+G++ GA+ GG+ + LIES+ GY D T +G F V+ ++L +RP G Sbjct: 236 IIGGLGSVPGAIFGGLTIALIESV-VGYYFDGTMATIG-------MFCVVALLLLIRPQG 287 Query: 300 IMG 302 ++G Sbjct: 288 MLG 290 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 294 Length adjustment: 27 Effective length of query: 282 Effective length of database: 267 Effective search space: 75294 Effective search space used: 75294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory