Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate BPHYT_RS31745 BPHYT_RS31745 ABC transporter ATP-binding protein
Query= uniprot:D8IUY5 (404 letters) >FitnessBrowser__BFirm:BPHYT_RS31745 Length = 389 Score = 430 bits (1105), Expect = e-125 Identities = 222/372 (59%), Positives = 270/372 (72%), Gaps = 22/372 (5%) Query: 17 ISLLLLLALMIVFPFVAQQFGNSWVRIMDVALLYIMLALGLNVVVGFAGLLDLGYIAFYA 76 IS L + + + + GN VR++D A+LY+MLALGLN+VVGFAGLLDLGYIAFYA Sbjct: 25 ISALTAIGVTALPLLIGAAAGNYGVRVLDFAMLYVMLALGLNIVVGFAGLLDLGYIAFYA 84 Query: 77 IGAYSAGLLASPQFAAVIESFVNTYPSVGNFLVWLCGPEIVQNGIHLSLWLIVPISAFLA 136 +GAY+A LL SP AA E + +PS G H W ++P++ LA Sbjct: 85 VGAYTAALLTSPHLAAHFEWIGHMWPS----------------GFHAPYWFVMPVAMVLA 128 Query: 137 ALFGALLGAPTLKLRGDYLAIVTLGFGEIIRIFMNNLNAPVNITNGPQGINLIDPIKVFG 196 A+ G LGAPTL+LRGDYLAIVTLGFGEI+RIFMNNL+ PVNITNGPQGI + P+ V G Sbjct: 129 AIAGICLGAPTLRLRGDYLAIVTLGFGEIVRIFMNNLDRPVNITNGPQGITGVAPVTVAG 188 Query: 197 VSLAGEPGSGSMVKVFGMSMPSVNAYYFLFLLLCIGVIFFSVRLQDSRLGRAWVAIREDE 256 +L+ G +V YY++F+L + V++ RLQ SR+GRAW AIREDE Sbjct: 189 FNLSETHA------FLGFQFTTVYMYYYVFVLCSLLVVWVCTRLQHSRIGRAWAAIREDE 242 Query: 257 IAAKAMGINTRNVKLLAFAMGASFGGVAGAMFGAFQGFVSPESFSLTESIAVLAMVVLGG 316 IAAKAMGINTRNVKLLAFAMGASFGG++GAMF FQGFVSPESF+L ES+ VLA VVLGG Sbjct: 243 IAAKAMGINTRNVKLLAFAMGASFGGLSGAMFAGFQGFVSPESFTLWESVTVLACVVLGG 302 Query: 317 IGHIPGVVLGGVILAALPEVLRHVVEPVQMAIFGKVWIDAEVLRQLLYGLAMVVIMLTRP 376 +GHIPGV+ G V+LA LPE+LR + P+Q AIFG V +D EV+RQLLYGLAMV+IML RP Sbjct: 303 MGHIPGVIFGAVLLAILPEILRSTMTPLQNAIFGHVIVDTEVIRQLLYGLAMVIIMLRRP 362 Query: 377 AGLWPSPRHEDR 388 GLWP+P+HEDR Sbjct: 363 EGLWPAPKHEDR 374 Lambda K H 0.327 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 389 Length adjustment: 31 Effective length of query: 373 Effective length of database: 358 Effective search space: 133534 Effective search space used: 133534 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory