Align GABA permease; 4-amino butyrate transport carrier; Gamma-aminobutyrate permease; Proline transporter GabP (characterized)
to candidate BPHYT_RS07280 BPHYT_RS07280 amino acid permease
Query= SwissProt::P46349 (469 letters) >FitnessBrowser__BFirm:BPHYT_RS07280 Length = 466 Score = 326 bits (836), Expect = 9e-94 Identities = 171/455 (37%), Positives = 272/455 (59%), Gaps = 4/455 (0%) Query: 3 QSQSGLKKELKTRHMTMISIAGVIGAGLFVGSGSVIHSTGPGAVVSYALAGLLVIFIMRM 62 + + GL++ L T ++MI+I G IG GLF+GSG I GP +VSYA+ L+ + +M Sbjct: 13 EREKGLQRGLSTGQLSMIAIGGAIGTGLFLGSGFAIGFAGPSVLVSYAIGALIALLLMGC 72 Query: 63 LGEMSAVNPTSGSFSQYAHDAIGPWAGFTIGWLYWFFWVIVIAIEAIAGAGIIQYWFHDI 122 L EM+ +PTSGSF YA I PWAGF + + YW V + E A A ++YWF + Sbjct: 73 LAEMTVAHPTSGSFGAYAEHYIAPWAGFLVRYAYWSSIVFAVGTEVTAIAVYMKYWFPAV 132 Query: 123 PLWLTSLILTIVLTLTNVYSVKSFGEFEYWFSLIKVVTIIAFLIVGFAFIFGFAPGSEPV 182 P W + + L N SVK FG EY FS++K+V I+ F+++G +FG AP + Sbjct: 133 PGWYWIVGFSAALIGINSVSVKVFGAVEYVFSMLKIVAIVGFILLGAYVVFG-APADSTI 191 Query: 183 GFSNLTGKGGFFPEGISSVLLGIVVVIFSFMGTEIVAIAAGETSNPIESVTKATRSVVWR 242 GF+N T GGFFP+G+ + + ++V IFS++ E++A+AAGE +P +++T+A R+ ++R Sbjct: 192 GFANYTSHGGFFPKGVWGMWVAVIVSIFSYLSIEMIAVAAGEARDPQKAITRAFRATMFR 251 Query: 243 IIVFYVGSIAIVVALLPWNSANILESPFVAVLEHIGVPAAAQIMNFIVLTAVLSCLNSGL 302 ++ FY+ ++A+++A++PWN+A ESPFV V+ VP AA ++NF++L A LS +NS L Sbjct: 252 LVFFYLLTLALMLAIVPWNAAGTDESPFVRVMAATHVPGAAGVINFVILVAALSAMNSQL 311 Query: 303 YTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTFFSYIAVVMNYFSPDTVFLFLVN 362 Y T+RM++SL+ APR+ L+ KGVPV A+ T +A V+N PD F+ +++ Sbjct: 312 YITTRMMFSLSRAGYAPRKLGALNGKGVPVAALWLSTIGIALATVLNVVYPDASFVLMMS 371 Query: 363 SSGAIALLVYLVIAVSQLKMRKKLEKTNPEALKIKMWLFPFLTYLTIIAICGILVSMAFI 422 S A+ +L+I V+ R + + L +MW +P + L + LV+ F Sbjct: 372 VSMFGAMFTWLMIFVTHFFFRHRHQGA---PLAFRMWGYPGTSALGAGLMVSALVTTWFT 428 Query: 423 DSMRDELLLTGVITGIVLISYLVFRKRKVSEKAAA 457 R L++ +L+ Y V+ +++ E AAA Sbjct: 429 REFRMTLVIGVPFIVSLLVVYFVWYRKRAVEGAAA 463 Lambda K H 0.326 0.140 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 601 Number of extensions: 32 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 466 Length adjustment: 33 Effective length of query: 436 Effective length of database: 433 Effective search space: 188788 Effective search space used: 188788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory