GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Burkholderia phytofirmans PsJN

Align Acyl-coenzyme A synthetase ACSM3, mitochondrial; Acyl-CoA synthetase medium-chain family member 3; Butyrate--CoA ligase 3; Butyryl-coenzyme A synthetase 3; Middle-chain acyl-CoA synthetase 3; Propionate--CoA ligase; Protein SA homolog; EC 6.2.1.2; EC 6.2.1.17 (characterized)
to candidate BPHYT_RS28035 BPHYT_RS28035 AMP-dependent synthetase

Query= SwissProt::Q3UNX5
         (580 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS28035 BPHYT_RS28035 AMP-dependent
           synthetase
          Length = 563

 Score =  353 bits (906), Expect = e-101
 Identities = 205/553 (37%), Positives = 303/553 (54%), Gaps = 22/553 (3%)

Query: 25  DYRTATPQNFSNYESMKQDFKIEIPEYFNFAKDVLDQWTNMEKAGKRLSNPAFWWIDGNG 84
           D R    ++ ++Y+   ++F       FN+A D  D         +   NPA W +D   
Sbjct: 9   DARDLLLRHRTDYDRAYREFAWPPLGEFNWALDYFDV------IARDNDNPALWIVDDPA 62

Query: 85  EE-LRWSFEELGLLSRKFANILTEACSLQRGDRVMVILPKIPEWWLANVACLRTGTVLIP 143
            + LR S+ ++   S + AN L     + RGDR++++LP   E W   +A ++ G +++P
Sbjct: 63  TDGLRLSYAQMSERSARMANFL-RGVGVGRGDRLLLMLPNRVELWDVMLAAMKLGAIVLP 121

Query: 144 GTTQLTQKDILYRLQSSKAKCIITDDTLAPAVDAVAAKCENLHSKLIVSQHSREGWGNLK 203
            TTQL+  D+  R+Q   A   + D       DA+ A    L          R+GW +L 
Sbjct: 122 ATTQLSADDVRDRVQIGGANFAVVDSAELAKFDALEAPLTRLSVGA-----PRDGWIDLA 176

Query: 204 EMMKYASDSHTCVDTKHDEMMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFWLDLIAS 263
                +        T   + M +YFTSGTT  PK++ HTH S+ +G  ++  +W+ L  +
Sbjct: 177 AAYDASPQFTPEGITLATDPMLLYFTSGTTSKPKLVEHTHQSYPVG-HLSTMYWIGLQPN 235

Query: 264 DVMWNTSDTGWAKSAWSSVFSPWTQGACVFAHYLPRFESTSILQTLSKFPITVFCSAPTA 323
           D+ WN S  GWAK AWS  F+PW   ACVF     RF     L  L +F IT  C+ PT 
Sbjct: 236 DIHWNISSPGWAKHAWSCFFAPWNAQACVFVFNFARFVPKDTLNALVRFNITTLCAPPTV 295

Query: 324 YRMLVQNDMSSYKFNSLKHCVSAGEPINPEVMEQWRKKTGLDIYEGYGQTETVLICGNFK 383
           +RMLVQ  +S Y    L+  V AGEP+NPEV+E+ +   G+ I +GYGQTET    GN  
Sbjct: 296 WRMLVQEHLSDYPVK-LREIVGAGEPLNPEVIERVKHAWGITIRDGYGQTETTCQIGNSP 354

Query: 384 GMKIKPGSMGKPSPAFDVKILDENGATLPPGQEGDIALQVLPERPFGLFTHYVDNPSKTA 443
           G  +  GSMG+P P + ++++D +     P  EG+I+L  L +RP GL T Y +N   TA
Sbjct: 355 GQPVVAGSMGRPLPGYTIELIDADDQ---PVTEGEISLP-LAQRPLGLMTGYANNAKATA 410

Query: 444 STLRGSFYITGDRGYMDEDGYFWFVARSDDIILSSGYRIGPFEVESALIEHPSIAESAVV 503
             +R  FY T D     +DGY+ +V R+DD+  SS YR+ PFE+ES LIEH +I E+AVV
Sbjct: 411 QAMRNGFYRTSDVALRRDDGYYVYVGRADDVFKSSDYRLSPFELESVLIEHEAIGEAAVV 470

Query: 504 SSPDPIRGEVVKAFIVLNPDYKSHDQEQLKKEIQEHVKKTTAPYKYPRKVEFIEELPKTV 563
            S D +R  V KAF+ +   Y++    +L + +    ++  APYK  R+++F  ELPKT+
Sbjct: 471 PSADALRLSVPKAFVTVRQGYEA--GPELARAVFAFSREKLAPYKRIRRLQF-SELPKTI 527

Query: 564 SGKVKRNELRKKE 576
           SGK++R ELR++E
Sbjct: 528 SGKIRRVELRRRE 540


Lambda     K      H
   0.319    0.134    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 849
Number of extensions: 49
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 580
Length of database: 563
Length adjustment: 36
Effective length of query: 544
Effective length of database: 527
Effective search space:   286688
Effective search space used:   286688
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory