Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate BPHYT_RS21555 BPHYT_RS21555 beta alanine--pyruvate aminotransferase
Query= reanno::SB2B:6938540 (460 letters) >FitnessBrowser__BFirm:BPHYT_RS21555 Length = 442 Score = 244 bits (623), Expect = 4e-69 Identities = 152/428 (35%), Positives = 225/428 (52%), Gaps = 18/428 (4%) Query: 23 PFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYGRKSIADAAYAQLQ 82 PFT + K R++E A+G+Y G ++LD AGLWCVN G+GR+ I A QL Sbjct: 16 PFTANRQF-KAAPRLLESAKGMYYRSTDGREVLDGCAGLWCVNAGHGREEIVAAITEQLS 74 Query: 83 TLPFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTGSGSEANDTNLRMVRRYWDLKGM 142 TL F F Q H A A+K+A L P ++R+FFT SGSE+ DT L++ Y +G Sbjct: 75 TLDFAPTF-QMGHPLAFEAATKVAELMPEGLDRIFFTNSGSESVDTALKIALAYHRSRGE 133 Query: 143 PSKKTIISRKNAYHGSTVAGASLGGMGFMHQ--QGDLPIPGIVHIDQPYWFGEGRDMSPE 200 + +I R+ YHG G S+GG+ + G L +P + H+ + + Sbjct: 134 GQRTRLIGRERGYHGVGFGGISVGGIAPNRKTFSGAL-LPAVDHLPHTHNLEHNAFTKGQ 192 Query: 201 -AFGIKTAQALEAKILELGEDKVAAFIAEPFQGAGGVIIPPDSYWNEIKRILEKYNILFI 259 A+G A+ LE + +AA I EP G+ GV+IPP Y +++ I K+ IL I Sbjct: 193 PAWGAHLAEELERIVTLHDASTIAAVIVEPVAGSTGVLIPPQGYLQKLREICTKHGILLI 252 Query: 260 LDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIVSDRVADVLISDGG-- 317 DEVI+ FGR G A++ G+ PDLIT+AK + + IPMG V S + D +++ G Sbjct: 253 FDEVITAFGRVGKATASEYFGVTPDLITMAKAINNAAIPMGAVAASRTIHDSIVNGGAQG 312 Query: 318 --EFAHGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRLQTLSAHPLVGEV 375 E HG+TYS HPVA A A+ + + + E L ++ T P + +L V +V Sbjct: 313 AIELFHGYTYSAHPVATAAAVATLDLYKREGLFERAAT-LAPTFEAAAHSLRGAKHVKDV 371 Query: 376 RGMGMVGAIELVADKHSMVRFGSEISAGMLCREACIESGLVMRAVGDTMIISPPLCITRD 435 R +GM+ +EL + R G+ + C E+G+++R GD + SPPL I + Sbjct: 372 RNLGMIAGVELES------RDGAPGARAYEAFVKCFEAGVLVRFTGDILAFSPPLIINEE 425 Query: 436 EIDELIFK 443 +I IFK Sbjct: 426 QIAH-IFK 432 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 442 Length adjustment: 33 Effective length of query: 427 Effective length of database: 409 Effective search space: 174643 Effective search space used: 174643 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory