Align putrescine transport system permease protein PotH (characterized)
to candidate BPHYT_RS11440 BPHYT_RS11440 putrescine/spermidine ABC transporter permease
Query= CharProtDB::CH_088338 (317 letters) >FitnessBrowser__BFirm:BPHYT_RS11440 Length = 309 Score = 364 bits (934), Expect = e-105 Identities = 170/288 (59%), Positives = 229/288 (79%) Query: 28 GRKLVIALPYIWLILLFLLPFLIVFKISLAEMARAIPPYTELMEWADGQLSITLNLGNFL 87 GR V+A P+IWL+L FL+PFL+V KIS A++ IPPYTEL +ADG + ITL+L ++ Sbjct: 20 GRTAVVAGPFIWLLLFFLVPFLLVVKISFADLQLGIPPYTELTNFADGAIHITLDLSHYA 79 Query: 88 QLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVILPSWTSF 147 L D LYF Y+ S+ VAAIST CLLIGYP+A+ +A S P +RN+L++ V+LP WTSF Sbjct: 80 FLLTDSLYFATYVNSVVVAAISTLLCLLIGYPMAYYIARSNPGSRNLLMMAVMLPFWTSF 139 Query: 148 LIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYVPFMVLPIYTAL 207 LIRVYAW+GILKNNG+LNNFL+ +G+I P+ + HTN AVYIG+VY+Y+PF+V+P+Y L Sbjct: 140 LIRVYAWIGILKNNGLLNNFLMSIGLIHSPIELYHTNTAVYIGMVYSYLPFLVMPLYAHL 199 Query: 208 IRIDYSLVEAALDLGARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEFVIPELLGGPDS 267 +++D +L+EAA DLGA+P K F+ + +PL+K GIIAG +LVFIPAVGE+VIPELLGG ++ Sbjct: 200 VKMDMTLLEAAYDLGAKPWKAFWQITLPLSKNGIIAGCLLVFIPAVGEYVIPELLGGANT 259 Query: 268 IMIGRVLWQEFFNNRDWPVASAVAIIMLLLLIVPIMWFHKHQQKSVGE 315 +MIGRV+W EFF+N DWP+ASAV M+LLL+VP+ +F Q K++ E Sbjct: 260 LMIGRVMWNEFFDNADWPMASAVTCAMVLLLLVPMAFFQYAQAKAMEE 307 Lambda K H 0.328 0.144 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 309 Length adjustment: 27 Effective length of query: 290 Effective length of database: 282 Effective search space: 81780 Effective search space used: 81780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory