Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate BPHYT_RS30500 BPHYT_RS30500 ABC transporter permease
Query= CharProtDB::CH_088337 (275 letters) >FitnessBrowser__BFirm:BPHYT_RS30500 Length = 302 Score = 176 bits (447), Expect = 4e-49 Identities = 83/231 (35%), Positives = 141/231 (61%), Gaps = 3/231 (1%) Query: 38 FTLDNYTRLLDPLYFEVLLHSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIV 97 FTL+NY R+ Y E L + ++++ T+ L+LGYP A+F A LP K+ L+L ++I+ Sbjct: 66 FTLENYRRMFTGAYLETFLLTFKLSIVVTVITLLLGYPVAYFAASLPPKLSALVLGMVIL 125 Query: 98 PFWTNSLIRIYGLKIFLSTKGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVM 157 PFWT+ L+R Y + L G +N+ LL G++D P+++ + +I +V+ILLPFMV+ Sbjct: 126 PFWTSVLVRTYAWLVLLQRTGLVNKALLASGLVDRPVQLAYNQFGTVIAMVHILLPFMVL 185 Query: 158 PLYSSIEKLDKPLLEAARDLGASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDL 217 PLYS+++K+ L +A LG S L F+R+ +PL++ G+ AG LV + +G + +L Sbjct: 186 PLYSAMQKIPSNLSQAGASLGGSPLHVFLRVFLPLSLSGVFAGVTLVFVLCLGFYITPEL 245 Query: 218 MGGAKNLLIGNVIKVQFLNIRDWPFGAATSITLTIVMGLMLLVYWRASRLL 268 MGG K++++ V+ W +A S+ L I + +++ ASR++ Sbjct: 246 MGGGKSIMVSMVVSRNVEIYNSWGAASAVSVVLLI---CVFAIFYAASRVV 293 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 302 Length adjustment: 26 Effective length of query: 249 Effective length of database: 276 Effective search space: 68724 Effective search space used: 68724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory