Align Putrescine-binding periplasmic protein SpuD (characterized)
to candidate BPHYT_RS26645 BPHYT_RS26645 ABC transporter substrate-binding protein
Query= SwissProt::Q02UB7 (367 letters) >FitnessBrowser__BFirm:BPHYT_RS26645 Length = 366 Score = 391 bits (1004), Expect = e-113 Identities = 186/360 (51%), Positives = 259/360 (71%), Gaps = 1/360 (0%) Query: 7 KTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVL 66 K LLA L G+ + A AD K L++YNW+DYIA DT+ F KE+GI V YDVYD +E L Sbjct: 7 KPLLAALLLGAFSA-ASLADEKQLNLYNWADYIAKDTVPNFEKESGIHVRYDVYDGDETL 65 Query: 67 EAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNE 126 +AKLL G +GYDVVVP+++FLAKQI+AG+YQKLDKSKLPN NL+++L+ + +DPGN+ Sbjct: 66 QAKLLTGSTGYDVVVPTSNFLAKQIEAGIYQKLDKSKLPNLANLDRNLLKLVADADPGNQ 125 Query: 127 HAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILP 186 +A+P+ WGT G+GYN +VK G+ AP+D+WD++FKPE + KLK CGVS LD+P+++ Sbjct: 126 YAVPWAWGTTGLGYNVTRVKKILGNEAPLDNWDILFKPEYLSKLKSCGVSVLDAPSDVFA 185 Query: 187 AALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIY 246 LHYLG P+++NP + +AA + KIRPY+T F+++ YI+DLA +IC A+ +SGD+ Sbjct: 186 VTLHYLGRDPNSENPADYQAAYDALKKIRPYITQFNATSYINDLAGDDICFALSWSGDVS 245 Query: 247 QAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEIT 306 A RA EA VKY IP+ GA +FDM+AIPKDA + E AL ++N++ +PE+ A+IT Sbjct: 246 MASHRAREAGKSYEVKYFIPEGGAPVWFDMMAIPKDAPHPEAALNWINYIERPEVHADIT 305 Query: 307 DVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSG 366 + V +PN +AAA V I NDP +YP E V+K L+ LPA+ +R R W ++KSG Sbjct: 306 NTVFYPNADAAARKFVRPEILNDPTVYPPEPVLKTLFLLKPLPAQIKRLEGRLWAQLKSG 365 Lambda K H 0.315 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 366 Length adjustment: 30 Effective length of query: 337 Effective length of database: 336 Effective search space: 113232 Effective search space used: 113232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory