GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mctC in Burkholderia phytofirmans PsJN

Align Monocarboxylic acid transporter (characterized)
to candidate BPHYT_RS25605 BPHYT_RS25605 symporter

Query= SwissProt::Q8NS49
         (551 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS25605 BPHYT_RS25605 symporter
          Length = 516

 Score =  394 bits (1011), Expect = e-114
 Identities = 214/532 (40%), Positives = 321/532 (60%), Gaps = 37/532 (6%)

Query: 20  ILNISVFVVFIIVTMTVVLRVGKSTSESTDFYTGGASFSGTQNGLAIAGDYLSAASFLGI 79
           +L I +F++ + VT+ +     + T  +++FY  G + S  +NG A+AGD++SAA+FLG 
Sbjct: 3   LLTIVIFMIILAVTLMITYWAARRTRTTSEFYAAGGNLSARENGFALAGDWMSAAAFLGF 62

Query: 80  VGAISLNGYDGFLYSIGFFVAWLVALLLVAEPLRNVGRFTMADVLSFRLRQKPVRVAAAC 139
            G +SL G DG LY++    A+LV L+L+AEP+RN GR+T  DV++ R+++   R+A   
Sbjct: 63  SGLVSLYGMDGSLYAVAALAAFLVVLMLIAEPVRNTGRYTFGDVIAERMKRPGARLATIV 122

Query: 140 GTLAVTLFYLIAQMAGAGSLVSVLLDIHEFKWQAVVVGIVGIVMIAYVLLGGMKGTTYVQ 199
           GT+ V L Y++ QMAGAG+L+ ++L +       V V +VGI MI YVL GGM  TT+VQ
Sbjct: 123 GTVVVNLAYMVPQMAGAGALIKLMLGVP----YDVAVVLVGIGMIVYVLFGGMIATTWVQ 178

Query: 200 MIKAVLLVGGVAIMTVLTFVKVSGGLTTLLNDAVEKHAASDYAATKGYDPTQILEPGLQY 259
           ++KA+LL+    ++  +    V      L   +VE+   S   A+ GY            
Sbjct: 179 IVKAMLLLVAACVLVSMLLAAVRFNPLALFA-SVERLYGSKMLASGGY------------ 225

Query: 260 GATLTTQLDFISLALALCLGTAGLPHVLMRFYTVPTAKEARKSVTWAIVLIGAFYLMTLV 319
                  LD +SL ++   G AGLPH++ RFYTVP A+ ARKSV W + L G+F+++T +
Sbjct: 226 ---FHHPLDTMSLFISFIFGVAGLPHIMTRFYTVPDARTARKSVLWLMFLAGSFFMVTTL 282

Query: 320 LGYGAAALVGPDRVIAAPGAANAAAPLLAF-------ELGGSIFMALISAVAFATVLAVV 372
           +G+ +A  VG D + AA    N A PLLA         LGG IF+A I A+AFA +LAVV
Sbjct: 283 IGFASAVFVGQDAIRAADKGGNLALPLLAQYLGGGAGSLGGQIFLASICAIAFAAILAVV 342

Query: 373 AGLAITASAAVGHDIYNAVIRNGQSTEAEQVRVSRITVVVIGLISIVLGILAMTQNVAFL 432
           AGL + +S A+ HD+Y  V+R G  ++AEQVRV+RI  V +G+ +I L +LA   NV  L
Sbjct: 343 AGLTLASSGAIAHDLYVNVLRKGAVSDAEQVRVARIATVAVGIAAIGLSLLAQGLNVGVL 402

Query: 433 VALAFAVAASANLPTILYSLYWKKFNTTGAVAAIYTGLISALLLIFLSPAVSGNDSAMVP 492
           V LA +VAAS+N P IL S++W++FNT G +  +  GL S++ L F+ PA  G+      
Sbjct: 403 VILAISVAASSNFPIILLSIFWRRFNTAGVIGGVIGGLTSSVALAFVGPAFMGSH----- 457

Query: 493 GADWAIFPLKNPGLVSIPLAFIAGWIGTLVGKPDNMDDLAAE-MEVRSLTGV 543
               A+FP+ NP +VS+P+   + W+ T++ +P    D   E   +R+ TG+
Sbjct: 458 ----ALFPIVNPAIVSLPIGLFSAWLCTMLSRPTPTQDGDFEAFYLRAQTGI 505


Lambda     K      H
   0.324    0.138    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 623
Number of extensions: 31
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 551
Length of database: 516
Length adjustment: 35
Effective length of query: 516
Effective length of database: 481
Effective search space:   248196
Effective search space used:   248196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory