GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aldA in Burkholderia phytofirmans PsJN

Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate BPHYT_RS23175 BPHYT_RS23175 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase

Query= metacyc::MONOMER-16244
         (495 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS23175 BPHYT_RS23175
           gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
          Length = 497

 Score =  363 bits (932), Expect = e-105
 Identities = 212/479 (44%), Positives = 286/479 (59%), Gaps = 14/479 (2%)

Query: 24  FINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSS-WSTSDPQV 82
           FI+ E+  ++  +TF  +SP   + + +V ++ + D+D AV AA  AF S  WS  +P+ 
Sbjct: 23  FIDGEYRDAEGGRTFDCLSPIDGKLLAKVADSGAADVDAAVAAARRAFDSGVWSGLNPRQ 82

Query: 83  RMKVLYKLADLIDEHADTLAHIEALDNGKSLMCSKGDVALTAAYFRSCAGW----TDKIK 138
           R  VL + A  I EH D LA +E LD GK +  +       AAY   C  W     DKI 
Sbjct: 83  RKAVLLRWAASIREHMDELALLETLDAGKPIADTTSVDVPGAAY---CVEWFAEAIDKIG 139

Query: 139 GSVIETGDTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLS 198
           G V            REPIGV   ++PWNFP+LMASWK GP L  G + VLK +E +PL+
Sbjct: 140 GEVAPADHHLLGLVTREPIGVVAAVVPWNFPILMASWKFGPALAAGNSVVLKPSEKSPLT 199

Query: 199 ALYLASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAES 258
           A+ LA L  +AG P GV NVV G G   G  ++ H  +  +AFTGST  G+ IM+ A +S
Sbjct: 200 AIRLAQLALDAGIPAGVFNVVPGAGEP-GKLLALHQDVDCLAFTGSTNVGKLIMQYAGQS 258

Query: 259 NLKKVTLELGGKSPNIVFDDA-DVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIV 317
           NLK+V LELGGKSPNIV  D  D+          IFYN GE+C AGSR+ V   I D  +
Sbjct: 259 NLKRVWLELGGKSPNIVMPDCPDMDRAANAAAGAIFYNMGEMCTAGSRLLVHRDIKDVFI 318

Query: 318 SEFKNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERFGNK-- 375
            +   AA S   G+P   DT MGA   ++QL+++L YI+ G+ E A ++ GG R      
Sbjct: 319 DKLIAAARSYTPGNPLDPDTSMGAIVDKVQLERVLGYIEAGRAE-AKLLLGGARVKEDTG 377

Query: 376 GYFIKPTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHTTNLS 435
           G++I+PTIF       ++ R+EIFGPV+++  F TVEE I +ANDSEYGLAA V T+NL+
Sbjct: 378 GFYIEPTIFEIPGSGAKVAREEIFGPVLSVITFDTVEEAIRIANDSEYGLAAAVWTSNLT 437

Query: 436 TAISVSNKINSGTIWVNTYNDFHPM-VPFGGYSQSGIGREMGEEALDNYTQVKAVRIGL 493
           TA  VS K+ +GT+WVN Y++   M  PFGGY QSG GR+    AL+ YT++K+  + L
Sbjct: 438 TAHEVSRKLRAGTVWVNCYDEGGDMNFPFGGYKQSGNGRDKSLHALEKYTELKSTLVRL 496


Lambda     K      H
   0.316    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 558
Number of extensions: 17
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 495
Length of database: 497
Length adjustment: 34
Effective length of query: 461
Effective length of database: 463
Effective search space:   213443
Effective search space used:   213443
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory