Align RhaQ (characterized, see rationale)
to candidate BPHYT_RS28205 BPHYT_RS28205 ATPase
Query= uniprot:Q7BSH2 (337 letters) >FitnessBrowser__BFirm:BPHYT_RS28205 Length = 338 Score = 221 bits (563), Expect = 2e-62 Identities = 123/332 (37%), Positives = 198/332 (59%), Gaps = 7/332 (2%) Query: 7 QPEKRIIPDRLGTPLRRIAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEK 66 +P+ ++ + TPL+ WEVLL V +L L SP FL NLS+ + TE Sbjct: 3 KPDSALLTRKRETPLQ-----WEVLLVIVLILSLALGRLLSPVFLTGANLSNVLADLTEI 57 Query: 67 AMIAFAMALLVISGEIDLSVAAIIALASTAMGAAVQIGIGTPGLVLIGIGTGLACGVFNG 126 A++A M L++++ EIDLSVA+++ +S MG +G+ P ++++ + G G+ NG Sbjct: 58 ALMALPMTLIIVAAEIDLSVASVLGASSALMGVLWHMGLPMPLVIVLVLVAGALAGLLNG 117 Query: 127 VLVSVLKLPSIVVTIGTMSLFRGISYIVLGDQAYGKYPADFAYFGQGYVVWVF-SFEFVL 185 +++ L LPS+ VTIGT++LFRG++Y++LGDQA +P + FG + F FV+ Sbjct: 118 LVIVKLNLPSLAVTIGTLALFRGLAYVLLGDQAVADFPPAYTAFGMDTLGGSFIPLPFVI 177 Query: 186 FIVLAVLFAILLHATNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCL 245 IV A++F +LL +T FGR +YAIG N AA FSGI V +++ LF+L+G MS +A V Sbjct: 178 VIVGAIVFTVLLQSTAFGRSLYAIGANPTAAAFSGIEVAKIRLRLFVLSGAMSALAGVVY 237 Query: 246 TSRLGSTRPSIAQGWELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNL 305 T R S R +G+EL V+ V+ GG+SI GG GV +++ ++G++ L L ++ Sbjct: 238 TLRFTSARGDNGEGFELSVIAAVLFGGVSIFGGRGSMIGV-LLSLLIIGVLKNALTLDDV 296 Query: 306 PGIVMSIFIGLLIIVTIAIPIIARRIKLMSSR 337 ++I G+L++ ++ IP + R + R Sbjct: 297 SSETLTIVTGVLLLASVLIPNLVARWRAARDR 328 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 338 Length adjustment: 28 Effective length of query: 309 Effective length of database: 310 Effective search space: 95790 Effective search space used: 95790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory