GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rbsA in Burkholderia phytofirmans PsJN

Align Ribose ABC transporter ATPase; SubName: Full=Sugar ABC transporter ATP-binding protein; SubName: Full=Sugar ABC transporter ATPase (characterized, see rationale)
to candidate BPHYT_RS11215 BPHYT_RS11215 ribose ABC transporter ATPase

Query= uniprot:A0A1N7TZ92
         (517 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS11215 BPHYT_RS11215 ribose ABC
           transporter ATPase
          Length = 532

 Score =  713 bits (1841), Expect = 0.0
 Identities = 377/512 (73%), Positives = 430/512 (83%), Gaps = 8/512 (1%)

Query: 8   AVLSVSGIGKTYAQPVLSDITLTLNRGEVLALTGENGAGKSTLSKIIGGLVTPTTGHMQF 67
           AVLSVSGIGKTYA+PVL+DI+L+L  GEVLALTGENGAGKSTLSKIIGGLV PT G MQ 
Sbjct: 11  AVLSVSGIGKTYAEPVLADISLSLRAGEVLALTGENGAGKSTLSKIIGGLVEPTAGTMQL 70

Query: 68  NGQDFRPGSRTQAEELGVRMVMQELNLLPTLTVAENLFLDNLPS----HCGWISRKQLRK 123
            G  + P SRTQAE LGVRMVMQELNLLPTL+VAENLFL+ LP       GWI R++LR+
Sbjct: 71  GGVPYAPASRTQAEALGVRMVMQELNLLPTLSVAENLFLNRLPRAGAFSFGWIDRRKLRE 130

Query: 124 AAIEAMAQVGLDAIDPDTLVGSLGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAREVEM 183
            A +AMAQVGLDAIDPDTLVG LGIGHQQMVEIARNLI DC VLILDEPTAMLTAREV++
Sbjct: 131 DARQAMAQVGLDAIDPDTLVGELGIGHQQMVEIARNLIDDCRVLILDEPTAMLTAREVDL 190

Query: 184 LFEQITRLQARGVAIIYISHRLEELARVAQRIAVLRDGKLVCVEPMANYNSEQLVTLMVG 243
           LFEQI RL+ARGVA++YISHRLEELARVA++IAVLRDG+LV V+ MAN  S+++VT MVG
Sbjct: 191 LFEQIDRLKARGVALVYISHRLEELARVAEQIAVLRDGRLVHVDAMANLTSDEIVTWMVG 250

Query: 244 RELGEHIDLGPRTIGGPALTVKGLTRSDKVRDVSFEVRAGEIYGISGLIGAGRTELLRLI 303
           RELGE IDLG R IG P L V  LTR   VR+VSFEVRAGEI+GISGLIGAGRTEL+RLI
Sbjct: 251 RELGERIDLGVRNIGAPLLKVDRLTRGKVVREVSFEVRAGEIFGISGLIGAGRTELMRLI 310

Query: 304 FGADLADSGTVAL----GSPAQVVSIRSPVDAVGHGIALITEDRKGEGLLLTQSISANIA 359
           +GAD  DSGTV+L    G+P   V I SP DAV  GIALITEDRKGEGLLL Q I+AN++
Sbjct: 311 YGADPKDSGTVSLAATPGAPPTPVQIASPSDAVRAGIALITEDRKGEGLLLPQPIAANVS 370

Query: 360 LGNMPEISGGGVVNSRDETALAKRQIDAMRIRSSSPAQLVSELSGGNQQKVVIGRWLERD 419
           LGN+  ++  G+V+++ E ALA+ QI AMRIR+S P Q+V ELSGGNQQKVVIGRWL RD
Sbjct: 371 LGNIGSVARHGIVDAKRENALAQTQIAAMRIRTSGPGQIVGELSGGNQQKVVIGRWLARD 430

Query: 420 CSVMLFDEPTRGIDVGAKFDIYALLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGRL 479
           C V+LFDEPTRGIDVGAKFDIY L+G L R+G+ALVVVSSDLRELMLICDRIGV+SAG +
Sbjct: 431 CRVLLFDEPTRGIDVGAKFDIYGLMGALAREGRALVVVSSDLRELMLICDRIGVMSAGSM 490

Query: 480 IETFERDSWTQDELLAAAFAGYQKRDALLNDA 511
              FERD+W+QD LLAAAFAGY+ R+ALL+ A
Sbjct: 491 TGVFERDNWSQDALLAAAFAGYRSREALLHAA 522


Lambda     K      H
   0.319    0.136    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 913
Number of extensions: 38
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 517
Length of database: 532
Length adjustment: 35
Effective length of query: 482
Effective length of database: 497
Effective search space:   239554
Effective search space used:   239554
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory