Align Ribokinase (EC 2.7.1.15) (characterized)
to candidate BPHYT_RS20695 BPHYT_RS20695 ribokinase
Query= reanno::pseudo1_N1B4:Pf1N1B4_6031 (305 letters) >FitnessBrowser__BFirm:BPHYT_RS20695 Length = 310 Score = 315 bits (808), Expect = 7e-91 Identities = 167/300 (55%), Positives = 213/300 (71%), Gaps = 2/300 (0%) Query: 4 KVVVIGSLNMDLVTRAPRLPRGGETLIGKSFATVSGGKGANQAVAAARLGAQVSMVGCVG 63 +V+V+GS+N DLV RAP LPR GET+ G F+ V+GGKG NQAVAAAR+GAQV+MVGCVG Sbjct: 9 RVLVVGSINTDLVARAPHLPRPGETIGGHEFSQVAGGKGGNQAVAAARIGAQVAMVGCVG 68 Query: 64 NDAYGEALRGALLAEQIDCQAVSTVEDS-SGVALIVVDDNSQNAIVIVAGANGALTPEVI 122 DA G L AE IDC + +GVA++ V D+ QN IV+VAG+NG LTPE + Sbjct: 69 KDANGAQRVKDLEAEGIDCSGIEVHPGQPTGVAMVTVSDDGQNTIVVVAGSNGELTPESV 128 Query: 123 DRFDAVLQAADVIICQLEVPDATVGHALKRGRELGKTVILNPAPASRPLPVDWYAAIDYL 182 R +A ++A DV++CQLE P +V L R LGK +LNPAPA+ PLP +W +DYL Sbjct: 129 ARHEAAIKACDVVVCQLETPWDSVHATLALARRLGKITVLNPAPATGPLPAEWLPLVDYL 188 Query: 183 IPNESEASVLSGLPVDSLSTAETAATRLIAMGAGKVIITLGSQGS-LFADGQRFEHFPAA 241 +PNE EA++L+GLPV+S S A AAT L GA VI+TLG+QG+ L +G HFPA Sbjct: 189 VPNEVEAAILAGLPVESQSGARRAATELQQGGARNVIVTLGAQGAYLLVEGGEGMHFPAP 248 Query: 242 KVKAVDTTAAGDTFVGGFAAALAAGKGEADAIRFGQVAAALSVTRAGAQPSIPTLSDVQA 301 +V+AVDTTAAGDTF+G FAA LA+ + AI Q AA++SVTRAGAQPSIPT ++V + Sbjct: 249 QVQAVDTTAAGDTFIGVFAAQLASRQPLESAISLAQRAASISVTRAGAQPSIPTRAEVDS 308 Lambda K H 0.316 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 310 Length adjustment: 27 Effective length of query: 278 Effective length of database: 283 Effective search space: 78674 Effective search space used: 78674 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate BPHYT_RS20695 BPHYT_RS20695 (ribokinase)
to HMM TIGR02152 (rbsK: ribokinase (EC 2.7.1.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02152.hmm # target sequence database: /tmp/gapView.31453.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02152 [M=298] Accession: TIGR02152 Description: D_ribokin_bact: ribokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-116 373.5 2.3 4.6e-116 373.3 2.3 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS20695 BPHYT_RS20695 ribokinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS20695 BPHYT_RS20695 ribokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 373.3 2.3 4.6e-116 4.6e-116 1 297 [. 10 307 .. 10 308 .. 0.99 Alignments for each domain: == domain 1 score: 373.3 bits; conditional E-value: 4.6e-116 TIGR02152 1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlgaevsmigkvGkDefgeellen 70 ++vvGSin+Dlv+r+++lp+pGet+ ++ef+++aGGKG NQAvaaar+ga+v+m+g+vGkD+ g++ +++ lcl|FitnessBrowser__BFirm:BPHYT_RS20695 10 VLVVGSINTDLVARAPHLPRPGETIGGHEFSQVAGGKGGNQAVAAARIGAQVAMVGCVGKDANGAQRVKD 79 79******************************************************************** PP TIGR02152 71 lkkegidteyvkkvkktstGvAlilvdeegeNsIvvvaGaneeltpedvkaaeekikesdlvllQlEipl 140 l++egid++ ++ + ++tGvA+++v+++g+N+IvvvaG+n eltpe v+++e++ik++d+v++QlE+p lcl|FitnessBrowser__BFirm:BPHYT_RS20695 80 LEAEGIDCSGIEVHPGQPTGVAMVTVSDDGQNTIVVVAGSNGELTPESVARHEAAIKACDVVVCQLETPW 149 ********************************************************************** PP TIGR02152 141 etveealkiakkagvkvllnPAPaekkldeellslvdiivpNetEaeiLtgievedledaekaaekllek 210 ++v++ l +a++ g+ ++lnPAPa+ l++e+l lvd++vpNe Ea+iL g ve+++ a++aa++l++ lcl|FitnessBrowser__BFirm:BPHYT_RS20695 150 DSVHATLALARRLGKITVLNPAPATGPLPAEWLPLVDYLVPNEVEAAILAGLPVESQSGARRAATELQQG 219 ********************************************************************** PP TIGR02152 211 gvkaviitlGskGallvskd.ekklipalkvkavDttaAGDtFigalavaLaegksledavrfanaaaal 279 g+++vi+tlG++Ga+l+ ++ e ++pa +v+avDttaAGDtFig +a++La+ + le+a++ a++aa++ lcl|FitnessBrowser__BFirm:BPHYT_RS20695 220 GARNVIVTLGAQGAYLLVEGgEGMHFPAPQVQAVDTTAAGDTFIGVFAAQLASRQPLESAISLAQRAASI 289 **************998777699*********************************************** PP TIGR02152 280 sVtrkGaqssiPtkeeve 297 sVtr+Gaq+siPt++ev+ lcl|FitnessBrowser__BFirm:BPHYT_RS20695 290 SVTRAGAQPSIPTRAEVD 307 ****************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.70 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory