Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate BPHYT_RS28270 BPHYT_RS28270 ABC transporter substrate-binding protein
Query= uniprot:A0A165KTD4 (375 letters) >FitnessBrowser__BFirm:BPHYT_RS28270 Length = 373 Score = 343 bits (881), Expect = 3e-99 Identities = 182/372 (48%), Positives = 245/372 (65%), Gaps = 5/372 (1%) Query: 4 KLKLTVVAAIAAAAGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGVT 63 +L +T A +AA ++++ + VV IGH AP++G QA GKDNENGAR+AI+ELN GVT Sbjct: 3 RLAMTAAALMAAGFTLSASAQVVVTIGHSAPLTGPQAPNGKDNENGARLAIDELNKSGVT 62 Query: 64 IGGKKIKFELVAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPH 123 + G+K+ F+L +EDD ADPK G AQKL D+ V VVG NSG IPAS+VYN +P Sbjct: 63 VAGQKVTFKLDSEDDQADPKIGVQVAQKLVDSGVVAVVGPYNSGVAIPASRVYNTGNVPM 122 Query: 124 VTGAATNPNLTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGVAD 183 + A+NP LT+ G+K FRI A+D LG + +A TLK KT A+IDDRTAYGQGVA+ Sbjct: 123 LP-VASNPALTRQGFKNIFRIGASDEQLGGTMGQFAAKTLKAKTAAVIDDRTAYGQGVAE 181 Query: 184 VFKKTATAKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQMEQL 243 F K A A G+++V+++FT ATDF++ILT IKAKNPD IF+GG QG PM +QM Q Sbjct: 182 QFVKVAKANGIQIVEQEFTNSSATDFLSILTTIKAKNPDVIFFGGYAAQGAPMAKQMRQR 241 Query: 244 GMGNVKYFGGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKYDAKYPNQ 303 G+ K GGDGIC++++ K+A A ++ V CA+GG +L K G + KY A Y Sbjct: 242 GL-RAKLLGGDGICSADMGKVAGEAASI--VYCAQGGIALEKTAAGREFLQKYKAAYNID 298 Query: 304 FQVYSPYTYDATFLIVDAMKRANSVDPKV-YTPELAKSSFKGVTSTIAFEPNGEMKNPAI 362 QVY+ YD L+ DAM +A + K T +LAK ++KGV T +F+ G++K Sbjct: 299 TQVYAVSYYDGVKLLADAMVKAGTTTDKAKLTAQLAKENYKGVAGTYSFDEYGDLKGAPT 358 Query: 363 TLYVYKDGKKTP 374 T+YV K+G TP Sbjct: 359 TVYVIKNGLPTP 370 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 373 Length adjustment: 30 Effective length of query: 345 Effective length of database: 343 Effective search space: 118335 Effective search space used: 118335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory