Align ABC transporter for D-Sorbitol, permease component 2 (characterized)
to candidate BPHYT_RS27975 BPHYT_RS27975 ABC transporter permease
Query= reanno::Phaeo:GFF1304 (288 letters) >FitnessBrowser__BFirm:BPHYT_RS27975 Length = 318 Score = 110 bits (274), Expect = 5e-29 Identities = 87/298 (29%), Positives = 137/298 (45%), Gaps = 23/298 (7%) Query: 1 MATQHSRSAARIMMAPAVILLLGWMLVPLTMTLYFSFKKY------LPLRGGDLGWVGFD 54 +A R+ A + + P V+LLL + PL L SF + +P R +VG D Sbjct: 24 LAGLSDRTIAWLFILPTVLLLLAINIFPLIWALRLSFTNFKSNMPSVPAR-----FVGID 78 Query: 55 NYARFLSSSAFWPSVQATLVIVGGVLAITVILGVFLALLLNQPMWGQGIVRILVIAPFFV 114 NY L+ W ++Q T V + + V+LG LALL+N+ G L++ P + Sbjct: 79 NYVDILTDEDIWYAMQVTARFVFWSVGLEVLLGFGLALLINRQFRGHSFWTTLILLPMML 138 Query: 115 MPTVSALVWKNMFMDPVNGLFAHLWKAF-GAEPVSW--LSEASLQ--SIILIVSWQWLPF 169 P V W + P GLF + F G P S+ + + SL +I+++ +W W P+ Sbjct: 139 SPAVVGNFW-TFLLQPQTGLFNDIVGFFTGIAPGSFQMIGDVSLAPWTIVMVDTWMWTPY 197 Query: 170 ATLILLTAIQSLDSEQLEAAEMDGAPPVARFGYITLPHLSRAITVVVLIQTIFLLSIFAE 229 LI L ++S+ EAAE+D A P +F ITLP + + VL + I +F Sbjct: 198 VMLICLAGLRSIPDYIYEAAEVDRATPWRQFWSITLPMTLPFLMLAVLFRGIENFKMFDM 257 Query: 230 IFVTTQGSFG--TKTLTYLIYQRVLESQNVGLGSAGGVYAII----LANIVAIFLMRI 281 + + T G G T+T++ + + E G SA + + ANI L R+ Sbjct: 258 VNLLTSGGPGSVTETVSITLKRAAFEKWQTGYSSALAIILFVTVFGAANIYVKALNRV 315 Lambda K H 0.328 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 318 Length adjustment: 27 Effective length of query: 261 Effective length of database: 291 Effective search space: 75951 Effective search space used: 75951 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory