Align ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, permease component 1 (characterized)
to candidate BPHYT_RS22780 BPHYT_RS22780 sugar ABC transporter permease
Query= reanno::WCS417:GFF2491 (276 letters) >FitnessBrowser__BFirm:BPHYT_RS22780 Length = 283 Score = 118 bits (295), Expect = 2e-31 Identities = 78/278 (28%), Positives = 135/278 (48%), Gaps = 15/278 (5%) Query: 6 SRRLQSLLLGTLAWAIAILIFF-PIFWMVLTSFKT-----EIDAFATPPQFIFTPTLENY 59 +RR+ L L +A+LI+ P+ +++TS ++ E + + P F +NY Sbjct: 13 TRRMYKLTL-----PVALLIWLLPMIAVLVTSVRSTEELSEGNYWGWPKHFAM---FDNY 64 Query: 60 LHINERSNYFSYAWNSVLISFSATALCLLISVPAAYSMAFYETQRTKGTLLWMLSTKMLP 119 S Y WNSVLI+ A + ++ A +++A Y + ++ +P Sbjct: 65 REALTTSPMLHYFWNSVLITVPAVVGSIALAAMAGFALAIYRFRGNSTLFATFVAGNFVP 124 Query: 120 PVGVLMPIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGA 179 +++P+ L+ GL +T ALI+ + + + K +P +++EAAR++GA Sbjct: 125 VQVLMIPVRDLSLQLGLFNTVSALILFHVSFQTGFCALFLRNFIKQLPFELVEAARIEGA 184 Query: 180 TLWQEMVRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLT-SSSAAPLTALIASYSSPEG 238 W +++LP+ + LA+ +L WN+ FW+L LT AAP+T +A+ Sbjct: 185 NEWTVFFKIVLPLIRPALAALAILVFTFVWNDYFWALCLTQGDDAAPITVGVAALKGQWT 244 Query: 239 LFWAKLSAVSTLACAPILIFGWISQKQLVRGLSFGAVK 276 W +SA S LA P + + QK V GL+FGA K Sbjct: 245 TAWNLVSAGSILAALPSVAMFFAMQKHFVAGLTFGATK 282 Lambda K H 0.327 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 283 Length adjustment: 26 Effective length of query: 250 Effective length of database: 257 Effective search space: 64250 Effective search space used: 64250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory