Align MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate BPHYT_RS33285 BPHYT_RS33285 sugar ABC transporter permease
Query= TCDB::O30493 (276 letters) >FitnessBrowser__BFirm:BPHYT_RS33285 Length = 269 Score = 141 bits (356), Expect = 1e-38 Identities = 77/257 (29%), Positives = 132/257 (51%), Gaps = 8/257 (3%) Query: 23 ILIFFPIFWMVLTSFKTE---IDAFATPPQFIFTPTLENYLHI-NERSNYFSYAWNSVLI 78 + P++WM+ S +T + AFA P + T +NY I + S Y+ Y NS++ Sbjct: 17 LFALIPLYWMLSISLRTNEETMSAFAIWPHHV---TFDNYKVIFTDPSWYWGYI-NSIIY 72 Query: 79 SFSATALCLLISVPAAYSMAFYETKRTKSTLLWMLSTKMLPPVGVLMPIYLLAKSFGLLD 138 T + +L+++PAAY+ + Y K W+L+ +M PP L+P + L S GL+D Sbjct: 73 VLMNTVMSVLVALPAAYAFSRYRFLGDKHMFFWLLTNRMTPPAVFLLPFFQLYSSVGLMD 132 Query: 139 TRIALIIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGATLWQEMVRVLLPIAKGGLA 198 T IA+ + + L N+P+ VW++ + +P++I E A +DG T +++ LP+ K G+ Sbjct: 133 TYIAVALAHMLFNVPLAVWILEGFMSGVPREIDETAYIDGYTFPAFFIKIFLPLIKSGVG 192 Query: 199 STVLLSLILCWNEAFWSLNLTSSNAAPLTALIASYSSPEGLFWAKLSAVSTLACAPILIF 258 T + W E + LT+ NA P+ A++ S G+ W LSA L P + Sbjct: 193 VTAFFCFMFSWVELLLARTLTTVNAKPIAAVMTRTVSAAGMDWGVLSAAGVLTIVPGALV 252 Query: 259 GWISQKQLVRGLSFGAV 275 + + + +G + G V Sbjct: 253 IYFVRNYIAKGFAMGRV 269 Lambda K H 0.327 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 269 Length adjustment: 25 Effective length of query: 251 Effective length of database: 244 Effective search space: 61244 Effective search space used: 61244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory