Align L-lactate dehydrogenase; EC 1.1.1.27 (uncharacterized)
to candidate BPHYT_RS28460 BPHYT_RS28460 malate dehydrogenase
Query= curated2:Q07251 (349 letters) >FitnessBrowser__BFirm:BPHYT_RS28460 Length = 363 Score = 152 bits (384), Expect = 1e-41 Identities = 106/336 (31%), Positives = 163/336 (48%), Gaps = 19/336 (5%) Query: 2 KISLTSARQLARDILAAQQVPADIADDVAEHLVESDRCGYISHGLSILPNYRTALDGHSV 61 ++ ARQ IL A + A+ L++SD G SHG+S+L Y + Sbjct: 3 RVGAAIARQQIEVILEAWGMSPGQVAASADILIDSDLKGIDSHGISMLMFYDQLYRAGQI 62 Query: 62 NPQGRAKCVLDQGTLMVFDGDGGFGQHVGKSVMQAAIERVRQHGHCIVTLRRSHHLGRMG 121 + + A+ V + T + DG+ G + M+ AIE+ V++ S H G G Sbjct: 63 DMKASARIVRETATTALIDGNAAMGHPTSRMAMELAIEKALACDMGAVSVFNSQHFGAAG 122 Query: 122 HYGEMAAAAGFVLLSFTNVINRAPVVAPFGGRVARLTTNPLCFAGPMPNGRPPLVVDIAT 181 +Y EMAA G L++ + R V P G L TNP FA P PP+++D++T Sbjct: 123 YYAEMAAERG--LIALVSCSTRLATVVPTFGAEPMLGTNPFAFATP-AGRHPPVILDMST 179 Query: 182 SAIAINKARVLAEKGEPAPEGSIIGADGNPTTDAS----TMFGEHPGALLP-------FG 230 S +A NK +V A +G+P P G + A+GNP TD++ +F G L P G Sbjct: 180 SVVASNKVKVYALQGKPLPPGWALDANGNPLTDSAEAYRLLFERLGGGLAPLGGDGKTLG 239 Query: 231 GHKGYALGVVAELLAGVLSGGGTIQP--DNPRGGVATNNL--FAVLLNPALDLGLDWQSA 286 GHKGY LG+ A++L L GGG+ P + + +N+ F + +NPA ++ A Sbjct: 240 GHKGYGLGLFAQILGSTL-GGGSFSPVRNRTQKSDEPDNIGHFFLAMNPAAFRPIEEYHA 298 Query: 287 EVEAFVRYLHDTPPAPGVDRVQYPGEYEAANRAQAS 322 +++A + L ++ PA V PG+ E RA S Sbjct: 299 DLDAVIDALRESQPADPAQPVLIPGDPERLTRAARS 334 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 349 Length of database: 363 Length adjustment: 29 Effective length of query: 320 Effective length of database: 334 Effective search space: 106880 Effective search space used: 106880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory