Align aminomethyltransferase; EC 2.1.2.10 (characterized)
to candidate BPHYT_RS19320 BPHYT_RS19320 glycine cleavage system protein T
Query= CharProtDB::CH_000563 (364 letters) >FitnessBrowser__BFirm:BPHYT_RS19320 Length = 372 Score = 351 bits (901), Expect = e-101 Identities = 199/376 (52%), Positives = 245/376 (65%), Gaps = 23/376 (6%) Query: 3 QQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRT 62 + TPL H ARMVDF GW MP++YGSQIDEH AVRTDAGMFDVSHM +VD G R Sbjct: 5 KHTPLNATHRALNARMVDFGGWDMPVNYGSQIDEHRAVRTDAGMFDVSHMCVVDFTGERV 64 Query: 63 REFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDL 122 R F Y LAN+VAKL G+ALYS +LN GGVIDDLIVYYF ED FR+VVN+ T +KD+ Sbjct: 65 RAFFEYALANNVAKLQTPGRALYSCLLNPDGGVIDDLIVYYFGEDHFRVVVNAGTADKDI 124 Query: 123 SWITQ-HAE-PFGIEITVRDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFFGVQA- 179 +W Q +AE FG+ IT R D +++AVQGPNA+ K A R A E +KPF + Sbjct: 125 AWFGQLNAEGSFGLTITPRRDYAIVAVQGPNAREKVWQTV-PAARAATEALKPFNAARIE 183 Query: 180 ----GDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNL 235 G+L +A TGYTGE G+EI +P + W AL GV+P GLGARDTLRLEAGMNL Sbjct: 184 DTPFGELTVARTGYTGEDGFEIIVPADHVEALWNALQAQGVRPAGLGARDTLRLEAGMNL 243 Query: 236 YGQEMDETISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEK-----G 290 YGQ+MD+ +SPL A + WT+ + RDF+G+ LE VGL++ ++ G Sbjct: 244 YGQDMDDNVSPLDAGLAWTVDL-TSPRDFVGKGKLEADGSQAA--FVGLILLKENGKAAG 300 Query: 291 VLRNELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVPEGI--GETAIVQIRNREMP 348 VLR V EG ITSGTFSPT+ SIA ARVP+G+ G+T VQIR++ +P Sbjct: 301 VLRAHQKVVTPHG-----EGEITSGTFSPTMQESIAFARVPKGVQPGDTVHVQIRDKNVP 355 Query: 349 VKVTKPVFVRNGKAVA 364 V K FVRNGK +A Sbjct: 356 ASVVKLPFVRNGKVLA 371 Lambda K H 0.320 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 372 Length adjustment: 30 Effective length of query: 334 Effective length of database: 342 Effective search space: 114228 Effective search space used: 114228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS19320 BPHYT_RS19320 (glycine cleavage system protein T)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.20564.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-121 390.5 0.0 3.7e-121 390.4 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS19320 BPHYT_RS19320 glycine cleavage s Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS19320 BPHYT_RS19320 glycine cleavage system protein T # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 390.4 0.0 3.7e-121 3.7e-121 1 362 [] 4 366 .. 4 366 .. 0.92 Alignments for each domain: == domain 1 score: 390.4 bits; conditional E-value: 3.7e-121 TIGR00528 1 lkrtpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrlla 70 lk+tpL h l +++vdf+Gw +Pv+y+s+i+eh+avrt+aG+fDvshm v+ +G+++++f+++ la lcl|FitnessBrowser__BFirm:BPHYT_RS19320 4 LKHTPLNATHRALNARMVDFGGWDMPVNYGSQIDEHRAVRTDAGMFDVSHMCVVDFTGERVRAFFEYALA 73 689******************************************************************* PP TIGR00528 71 nDvdaLtk.GkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeev..tldtl 137 n+v++L + G+a+ys lln++GGv+DDlivy++ged +f++vvna+ta+kD +w+ + +e++ +t lcl|FitnessBrowser__BFirm:BPHYT_RS19320 74 NNVAKLQTpGRALYSCLLNPDGGVIDDLIVYYFGED-HFRVVVNAGTADKDIAWFGQLNAEGSfgLTITP 142 ******655***************************.******************997666541156788 PP TIGR00528 138 skeisllalqGPkakt.ile..dlldkaveglkefffvqeaelalkkaliartGytGedGfeiavaneka 204 +++ +++a+qGP+a++ + + ++ ++a e+lk+f ++ + +artGytGedGfei+v+ ++ lcl|FitnessBrowser__BFirm:BPHYT_RS19320 143 RRDYAIVAVQGPNAREkVWQtvPAARAATEALKPFNAARIEDTPFGELTVARTGYTGEDGFEIIVPADHV 212 9999********9965276633567888899******99999999999********************** PP TIGR00528 205 velwkklveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkkerkksdfiGravleeq 274 lw++l ++ gv+P GLgarDtLrleagm+LyGq++d++++Pl+agl w+v + + +df+G+ +le lcl|FitnessBrowser__BFirm:BPHYT_RS19320 213 EALWNALQAQ-GVRPAGLGARDTLRLEAGMNLYGQDMDDNVSPLDAGLAWTVDLT-SPRDFVGKGKLEAD 280 *******999.********************************************.9**********865 PP TIGR00528 275 kengtekklvGlemle...k..giarnelkvlltngekevGivtsGtlsPtLgknialayvdkelekiGt 339 g++ vGl +l+ k g++r + kv++++g +G +tsGt+sPt++ +ia a+v+k++ + G+ lcl|FitnessBrowser__BFirm:BPHYT_RS19320 281 ---GSQAAFVGLILLKengKaaGVLRAHQKVVTPHG---EGEITSGTFSPTMQESIAFARVPKGV-QPGD 343 ...666667777777522233359*********999...9**********************887.57** PP TIGR00528 340 klevevrnklvkikvvkklfvrs 362 +++v++r+k v++ vvk +fvr+ lcl|FitnessBrowser__BFirm:BPHYT_RS19320 344 TVHVQIRDKNVPASVVKLPFVRN 366 *********************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.70 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory