Align Aminomethyltransferase; EC 2.1.2.10; Glycine cleavage system T protein (uncharacterized)
to candidate BPHYT_RS24765 BPHYT_RS24765 FAD-dependent oxidoreductase
Query= curated2:B8D1D7 (357 letters) >FitnessBrowser__BFirm:BPHYT_RS24765 Length = 831 Score = 162 bits (411), Expect = 2e-44 Identities = 105/300 (35%), Positives = 163/300 (54%), Gaps = 8/300 (2%) Query: 35 EHKAVRNQCGLFDVSHMGEILVEGPGALESLQKIVTNNVARLKKGQVLYTPMCKDDGGII 94 EH+A R LFD++ + LV+G A LQ +V N+V + G +YT M + GG Sbjct: 488 EHRACREGVALFDMTSFSKFLVKGRDAQSVLQGLVANDVD-VPNGTTVYTAMLNERGGYE 546 Query: 95 DDLLVYCLGQDKYLMVVNASNIEKDFNWVRDN--SNQRTEVVNESDNYALLALQGPNSKK 152 D + L D+YL+V + +DF+ + + ++ +V+ + YA+LA+ GP S++ Sbjct: 547 SDFTLTRLADDQYLLVTGTAQTTRDFDSIEKSIPHDRHCTLVDVTGQYAVLAVMGPRSRE 606 Query: 153 ILEKVSSVNL--DSLKFYNFTTGTLKGAEVLISRTGYTGELGYELYLSPDKAVEVWQALM 210 +L+ VS + ++ F L A V +R Y GELG+ELY+ + AV V++ L Sbjct: 607 LLQSVSKADWSNEAFAFGQSRELDLGYATVRATRLTYVGELGWELYVPVEFAVGVYETLH 666 Query: 211 EAGSDLGLIPAGLGARDTLRLEKGYCLYGNDIDENTHPLEAGLGWTVKFDK-ASFIGKRA 269 AG GL+ AG A D+LR+EKGY +G ++ +T+P EAGL + K DK +F G+ A Sbjct: 667 AAGKAFGLVNAGYYAIDSLRIEKGYRAWGRELTPDTNPFEAGLSFACKLDKDIAFRGRDA 726 Query: 270 LLKYKEEGLSRKLVGFKLKGR--GIPRHGYPIKDNGDQIGVVTSGSMSPTLSEGIGMGYV 327 LLK + E L R++V G + G I +G +G V+S + TL + MGYV Sbjct: 727 LLKLRAEPLRRRMVVLSANGATDRMLWGGEAILRDGKPVGFVSSAAFGHTLGCPVAMGYV 786 Lambda K H 0.317 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 704 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 831 Length adjustment: 35 Effective length of query: 322 Effective length of database: 796 Effective search space: 256312 Effective search space used: 256312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory