Align Aminomethyltransferase; EC 2.1.2.10; Glycine cleavage system T protein (uncharacterized)
to candidate BPHYT_RS25115 BPHYT_RS25115 sarcosine oxidase subunit alpha
Query= curated2:O86567 (372 letters) >FitnessBrowser__BFirm:BPHYT_RS25115 Length = 1000 Score = 151 bits (382), Expect = 7e-41 Identities = 116/355 (32%), Positives = 171/355 (48%), Gaps = 28/355 (7%) Query: 6 LRRTALDATHRALGATMTDFAGWDMPLRYGSERE--------EHVAVRTRAGLFDLSHMG 57 +R+TA+ H GA D W P Y E E +AVRT G+ D S +G Sbjct: 610 VRKTAVHEWHVENGAAFEDVGNWKRPWYYPKAGEDLHAAVARESLAVRTSVGILDASTLG 669 Query: 58 EITVTGPQAAELLNFALVGNIGTVKPGRARYTMICREDGGILDDLIVYRLEEAEYMVVAN 117 +I + GP +A+LLN+ ++ G+ RY ++ E+G I DD + RL + YM+ Sbjct: 670 KIDIQGPDSAKLLNWVYTNPWSKLEVGKCRYGLMLDENGMIFDDGVTVRLADQHYMMTTT 729 Query: 118 ASNAQVVLDALTE--RAAGFDAEVR--DDRDAYALLAVQGPESPGILASLTDADLD---- 169 A VL L + D VR D +A AV GP S +L + D+D Sbjct: 730 TGGAARVLTWLERWLQTEWPDMRVRLASVTDHWATFAVVGPNSRKVLQKVCQ-DIDFANA 788 Query: 170 GLKYYAGLPGTVAGVPALIARTGYTGEDGFELFVKPEHAVGLWQALTGAGEAAGLIPCGL 229 + + GTVAG + + R ++GE +E+ V +W+AL AG + P G Sbjct: 789 AFPFMSYREGTVAGAASRVMRISFSGELAYEVNVPANVGRAVWEALMAAGAEFDITPYGT 848 Query: 230 SCRDTLRLEAGMPLYGNELSTALTPFDAGLGRVVKFEKEGDFVGRAALTEAAERAASRPP 289 LR E G + G + ++TP+D G+G +V K DF+G+ +LT + A R Sbjct: 849 ETMHVLRAEKGYIIVGQDTDGSMTPYDLGMGGLV--AKSKDFLGKRSLTRSDTAKAGR-- 904 Query: 290 RVLVGLVAEGRR-VPRSGYRVVAG---GE---VIGEVTSGAPSPTLGRPIAMAYV 337 + LVGL+++ V G ++VAG GE ++G VTS SP L R IAMA V Sbjct: 905 KQLVGLLSDDPSFVIPEGSQIVAGPFQGETAAMLGHVTSSYYSPILKRSIAMAVV 959 Lambda K H 0.318 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 842 Number of extensions: 43 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 1000 Length adjustment: 37 Effective length of query: 335 Effective length of database: 963 Effective search space: 322605 Effective search space used: 322605 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory