Align hydroxyacylglutathione hydrolase; EC 3.1.2.6 (characterized)
to candidate BPHYT_RS14210 BPHYT_RS14210 hydroxyacylglutathione hydrolase
Query= CharProtDB::CH_024825 (251 letters) >FitnessBrowser__BFirm:BPHYT_RS14210 Length = 263 Score = 204 bits (519), Expect = 1e-57 Identities = 116/257 (45%), Positives = 154/257 (59%), Gaps = 14/257 (5%) Query: 6 IPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHVGGVKE 64 +PAFDDNYIWV++D GR +VDPG+A PV +A W+ AI LTHHH DHVGGV + Sbjct: 9 VPAFDDNYIWVVSD--GRHAAVVDPGEAAPVKAYLAKRGWRLSAILLTHHHQDHVGGVAD 66 Query: 65 LVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGH--EFSVIATPGHTLGHICYFSK-- 120 L+ + VYGP + T +K+G+ + + SV+ PGHT GHI YF Sbjct: 67 LLNG-QAVPVYGPAGEAIEHLTHRLKNGDHVSIAAPALKLSVLDVPGHTSGHIAYFQAAD 125 Query: 121 ----PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKFAL 176 P++FCGDTLF+ GCGRLFEGT QM SL L+ALP T V CAHEYTLSN++FAL Sbjct: 126 PQGTPHVFCGDTLFACGCGRLFEGTPKQMLASLDSLAALPGATEVHCAHEYTLSNIRFAL 185 Query: 177 SILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLLQQ 236 + P + + + K ELRA++ TLP + +ER +N FLR D + + E+ Sbjct: 186 ACEPGNAELQAWRDKASELRARDVPTLPTTIAHERAVNPFLRAGDPAVQASLREQLHEAV 245 Query: 237 PEE--RFAWLRSKKDRF 251 P+ F +R K+RF Sbjct: 246 PDRLTAFTLMREWKNRF 262 Lambda K H 0.321 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 263 Length adjustment: 24 Effective length of query: 227 Effective length of database: 239 Effective search space: 54253 Effective search space used: 54253 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate BPHYT_RS14210 BPHYT_RS14210 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.13720.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-103 330.5 0.0 3.3e-103 330.4 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS14210 BPHYT_RS14210 hydroxyacylglutath Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS14210 BPHYT_RS14210 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 330.4 0.0 3.3e-103 3.3e-103 2 248 .] 7 262 .. 6 262 .. 0.97 Alignments for each domain: == domain 1 score: 330.4 bits; conditional E-value: 3.3e-103 TIGR03413 2 iaipalsdNyiwllkdekseavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellekfpvkv 71 +++pa++dNyiw+++d + +a+vvDpgea+pv ++l+++g++l+aillTHhH+DHvggva+ll+ v+v lcl|FitnessBrowser__BFirm:BPHYT_RS14210 7 VPVPAFDDNYIWVVSDGR-HAAVVDPGEAAPVKAYLAKRGWRLSAILLTHHHQDHVGGVADLLNGQAVPV 75 589**************9.*************************************************** PP TIGR03413 72 vgpaeeripgltkevkegdevel..lelevevlevpGHtlgHiayyleee....kvlFcgDtLfsaGCGr 135 +gpa e+i++lt+++k+gd+v++ +l+++vl+vpGHt+gHiay+++++ +++FcgDtLf++GCGr lcl|FitnessBrowser__BFirm:BPHYT_RS14210 76 YGPAGEAIEHLTHRLKNGDHVSIaaPALKLSVLDVPGHTSGHIAYFQAADpqgtPHVFCGDTLFACGCGR 145 **********************955678999****************98888999*************** PP TIGR03413 136 lfegtaeqmleslqklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPst 205 lfegt++qml+sl+ laaLp +t+v+caHEYtlsN+rFala+ep n++l+++ +++++lra++ ptlP+t lcl|FitnessBrowser__BFirm:BPHYT_RS14210 146 LFEGTPKQMLASLDSLAALPGATEVHCAHEYTLSNIRFALACEPGNAELQAWRDKASELRARDVPTLPTT 215 ********************************************************************** PP TIGR03413 206 laeekatNpFLraeeaevkaalee....ekaeevevfaelRekkdkf 248 +a+e+a+NpFLra +++v+a+l+e + +++++f+ +Re+k++f lcl|FitnessBrowser__BFirm:BPHYT_RS14210 216 IAHERAVNPFLRAGDPAVQASLREqlheAVPDRLTAFTLMREWKNRF 262 *******************9999977766778999**********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (263 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.17 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory