Align palmitoyl-CoA hydrolase (EC 3.1.2.2) (characterized)
to candidate BPHYT_RS16145 BPHYT_RS16145 S-formylglutathione hydrolase
Query= BRENDA::P33018 (278 letters) >FitnessBrowser__BFirm:BPHYT_RS16145 Length = 283 Score = 291 bits (746), Expect = 8e-84 Identities = 146/281 (51%), Positives = 189/281 (67%), Gaps = 4/281 (1%) Query: 1 MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPP--RDHTPPPVLYWLSGLTCNDEN 58 +E+L H C G Q+ +RHDS T+ M FSI+LPP + + P L++L+GLTC +E Sbjct: 2 LELLSSHACHGGEQRIYRHDSQTIGLSMRFSIYLPPQALQANANVPALFYLAGLTCTEET 61 Query: 59 FTTKAGAQRVAAELGIVLVMPDTSPRGEKVANDDG-YDLGQGAGFYLNATQPPWATHYRM 117 F KAGAQR AA+ GI L+ PDTSPRG V + +D G GAGFY++ATQ PWA HYRM Sbjct: 62 FPVKAGAQRFAAQHGIALIAPDTSPRGAGVPGESAAWDFGVGAGFYVDATQQPWAQHYRM 121 Query: 118 YDYLRDELPALVQSQFNVSD-RCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCS 176 Y Y+RDEL +V + V R + GHSMGGHGAL++AL+NP Y SVSAFAPI P Sbjct: 122 YSYVRDELREMVLANLPVDGARLGVFGHSMGGHGALMLALRNPEIYRSVSAFAPIAAPTR 181 Query: 177 VPWGIKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLA 236 PWG KAFS YLG+D+ AW ++D+ L+ ++ + + L+DQG DQFLA+QL P V Sbjct: 182 CPWGEKAFSGYLGDDREAWKQYDASELVARTSRKFSEGILVDQGLADQFLAEQLNPDVFE 241 Query: 237 EAARQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQYLL 277 A + P+TLR GYDH YYFI++F+EDHL HA+ LL Sbjct: 242 AACQAAGQPLTLRRHAGYDHGYYFISTFVEDHLAHHAKVLL 282 Lambda K H 0.320 0.136 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 283 Length adjustment: 26 Effective length of query: 252 Effective length of database: 257 Effective search space: 64764 Effective search space used: 64764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory