GapMind for catabolism of small carbon sources

 

Aligments for a candidate for iolA in Burkholderia phytofirmans PsJN

Align malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18); methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate BPHYT_RS28030 BPHYT_RS28030 methylmalonate-semialdehyde dehydrogenase

Query= BRENDA::Q02252
         (535 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS28030 BPHYT_RS28030
           methylmalonate-semialdehyde dehydrogenase
          Length = 503

 Score =  603 bits (1556), Expect = e-177
 Identities = 282/489 (57%), Positives = 371/489 (75%)

Query: 32  SFSSSVPTVKLFIGGKFVESKSDKWIDIHNPATNEVIGRVPQATKAEMDAAIASCKRAFP 91
           S +++V TVKL I G+FVESK+ +W DI NPAT EV+ RVP AT  E++ AI S   AF 
Sbjct: 2   SANAAVATVKLLINGEFVESKTTEWRDIVNPATQEVLARVPFATADEVNEAIRSAHAAFK 61

Query: 92  AWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSV 151
            W DT + +R +++L+YQ LI+E+   IA+ ++ EQGKT+ DAEGD+FRGL+VVEHACS+
Sbjct: 62  TWKDTPIGARMRIMLKYQALIREHSPRIARTLSAEQGKTIPDAEGDIFRGLEVVEHACSI 121

Query: 152 TSLMMGETMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKPS 211
            +L  GE   ++   +D Y+ R P+GVCAGI PFNFPAMIPLWMFPMA+VCGNTF++KPS
Sbjct: 122 GTLQQGEFAENVAGGVDTYTLRQPIGVCAGITPFNFPAMIPLWMFPMAIVCGNTFVLKPS 181

Query: 212 ERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNKAGEYIFE 271
           E+ P +TM L +L  ++G P G LN++HG  E V+ +C H  +KA+SFVGS   G +++ 
Sbjct: 182 EQDPLSTMQLVELALEAGVPKGVLNVVHGGKEVVDALCTHELVKAVSFVGSTAVGTHVYR 241

Query: 272 RGSRHGKRVQANMGAKNHGVVMPDANKENTLNQLVGAAFGAAGQRCMALSTAVLVGEAKK 331
            GS HGKRVQ+ MGAKNH VV+PDAN+E TLN L GA FGAAGQRCMA S  VLVG A++
Sbjct: 242 LGSEHGKRVQSMMGAKNHAVVLPDANREQTLNALAGAGFGAAGQRCMATSVVVLVGAAQQ 301

Query: 332 WLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVK 391
           WLP+LV  A+ L+VNAG++P  D+GP+++  AK+R+  LI++G KEGA++ LDGR IKV 
Sbjct: 302 WLPDLVAKARTLKVNAGNEPNTDIGPVVSRAAKQRILGLIEAGVKEGATLALDGRDIKVP 361

Query: 392 GYENGNFVGPTIISNVKPNMTCYKEEIFGPVLVVLETETLDEAIQIVNNNPYGNGTAIFT 451
           GYE GNF+GPT+ S+V   M  Y++EIFGPVLVVL   TLD+AI +VN NP+GNG  +FT
Sbjct: 362 GYEQGNFIGPTVFSDVTTEMEIYRQEIFGPVLVVLNAATLDDAIALVNRNPFGNGVGLFT 421

Query: 452 TNGATARKYAHLVDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKT 511
            +GA ARK+   +D+GQVG+N+PIPVP+P FSFTGSR S  GD   YGKQ +QFYTQ KT
Sbjct: 422 QSGAAARKFQSEIDIGQVGINIPIPVPVPSFSFTGSRGSKLGDLGPYGKQVVQFYTQTKT 481

Query: 512 ITSQWKEED 520
           +T++W ++D
Sbjct: 482 VTARWFDDD 490


Lambda     K      H
   0.318    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 667
Number of extensions: 26
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 535
Length of database: 503
Length adjustment: 35
Effective length of query: 500
Effective length of database: 468
Effective search space:   234000
Effective search space used:   234000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory