Align 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase; AONS/AKB ligase; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; Alpha-oxoamine synthase; Glycine acetyltransferase; EC 2.3.1.29; EC 2.3.1.47 (characterized)
to candidate BPHYT_RS02160 BPHYT_RS02160 8-amino-7-oxononanoate synthase
Query= SwissProt::Q5SHZ8 (395 letters) >FitnessBrowser__BFirm:BPHYT_RS02160 Length = 394 Score = 226 bits (575), Expect = 1e-63 Identities = 135/389 (34%), Positives = 212/389 (54%), Gaps = 14/389 (3%) Query: 11 EELERLKREGLYISPKVLEAPQEPVTRVEGREVVNLASNNYLGFANHPYLKEKARQYLEK 70 E L+ + GL + + P V+GR ++ ASN+YLG A HP L + ++ Sbjct: 9 EGLKEIDARGLRRRRRTADTPCAAHMTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQR 68 Query: 71 WGAGSGAVRTIAGTFTYHVELEEALARFKG----TESALVLQSGFTANQGVLGALLKEGD 126 +GAGSG + G H +LE+ LA F G AL +G+ AN L AL G Sbjct: 69 YGAGSGGSHLLGGHSRAHAQLEDDLAEFAGGFVDNARALYFSTGYMANLATLTALAGRGT 128 Query: 127 VVFSDELNHASIIDGLRLTKATRLVFRHADVAHLEELLKAHDTDGLKLIVTDGVFSMDGD 186 +FSD LNHAS+IDG RL++A ++ H D L +L+A D D +K+IV+D VFSMDGD Sbjct: 129 TLFSDALNHASLIDGARLSRADVQIYPHCDTEALSAMLEASDAD-VKVIVSDTVFSMDGD 187 Query: 187 IAPLDKIVPLAKKYKAVVYVDDAHGSGVLGEKGKGTVHHFGFHQDPDVVQVATLSKAWAG 246 IAPL +++ LA+++ A + VDDAHG GVLG +G+G + + P+++ + TL KA Sbjct: 188 IAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQAAL-RSPNLISIGTLGKAAGV 246 Query: 247 IGGYAAGARELKDLLINKARPFLFSTSHPPAVVGALLGALELIEKEP-----ERVERLWE 301 G + + + L+ +ARP++F+T+ PA A+ +L +I E +++L E Sbjct: 247 SGAFVTAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEGDARRAHLQQLIE 306 Query: 302 NTRYFKRELARLGYDTLGSQTPITPVLFGEAPLAFEASRLLLEEGVFAVGIGFPTVPRGK 361 TR + L D S T + P++ G + + L G++ I PTVP G Sbjct: 307 RTRAMLKATPWLPVD---SHTAVQPLIIGANDATLDIAATLDRAGLWVPAIRPPTVPTGT 363 Query: 362 ARIRNIVTAAHTKEMLDKALEAYEKVGKR 390 +R+R ++AAH++ LD+ +++G + Sbjct: 364 SRLRISLSAAHSQADLDRLEAGLQQLGAK 392 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 394 Length adjustment: 31 Effective length of query: 364 Effective length of database: 363 Effective search space: 132132 Effective search space used: 132132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory