Align L-threonine dehydrogenase (EC 1.1.1.103) (characterized)
to candidate BPHYT_RS20205 BPHYT_RS20205 alcohol dehydrogenase
Query= ecocyc::EG12293-MONOMER (383 letters) >FitnessBrowser__BFirm:BPHYT_RS20205 Length = 386 Score = 197 bits (502), Expect = 3e-55 Identities = 123/355 (34%), Positives = 196/355 (55%), Gaps = 7/355 (1%) Query: 32 TRTLIVTDNMLTKLGMAGDVQKALEERNIFSVIYDGTQPNPTTENVAAGLKLLKENNCDS 91 +R +VTD L + G+ L + + D +P V + + Sbjct: 34 SRVCVVTDGFLHRSGLLNPALADLATHGWDATVIDDVIADPPEHIVLEATSRARTAGAEI 93 Query: 92 VISLGGGSPHDCAKGIALVAANGGD-IRDYEGVDRSAKPQLPMIAINTTAGTASEMTRFC 150 V+ LGGGS D AK IA++A + + GV++ +LP++ + TTAGT SE+T Sbjct: 94 VLGLGGGSSMDVAKLIAVLAPQQQQALSEMYGVNKITVARLPLVQMPTTAGTGSEVTAVS 153 Query: 151 IIT-DEARHIKMAIVDKHVTPLLSVNDSSLMIGMPKSLTAATGMDALTHAIEAYVSI-AA 208 I+T EA+ KM +V + L++ D+ L +G+P + TAATG+DA+ HAIEAY S Sbjct: 154 IVTVGEAK--KMGVVAPQLIADLAILDAELTLGLPVAATAATGVDAMVHAIEAYTSAHLK 211 Query: 209 TPITDACALKAVTMIAENLPLAVEDGSNAKAREAMAYAQFLAGMAFNNASLGYVHAMAHQ 268 P++D A+KA+ +++ NL A E+G + AREAM AG AF N+ + VHA+A+ Sbjct: 212 NPVSDLLAVKALDLLSRNLLPACENGDDRAAREAMLLGATFAGQAFANSPVAAVHALAYP 271 Query: 269 LGGFYNLPHGVCNAVLLPHVQVFNSKVAAARLRDCAAAMGVNVTGKNDAEGAEACINAIR 328 +GG Y++PHG+ NA++LPHV FN+ AA + A + VTG ++++ +A I + Sbjct: 272 IGGIYHVPHGLSNALVLPHVLRFNADAAAPLYAELAEVVVPGVTGSDESK-TQALIERLE 330 Query: 329 ELAKKVDIPAGLRDLNVKEEDFAVLATNA-LKDACGFTNPIQATHEEIVAIYRAA 382 ++ IPA LRD+ +++ +A++A L+ NP T + +AIY AA Sbjct: 331 QMIAATAIPARLRDVGIEQSGLERMASDAMLQTRLLVNNPRPVTEADALAIYTAA 385 Lambda K H 0.318 0.131 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 386 Length adjustment: 30 Effective length of query: 353 Effective length of database: 356 Effective search space: 125668 Effective search space used: 125668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory