Align L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 (characterized)
to candidate BPHYT_RS23440 BPHYT_RS23440 alcohol dehydrogenase
Query= SwissProt::Q8U259 (348 letters) >FitnessBrowser__BFirm:BPHYT_RS23440 Length = 348 Score = 165 bits (417), Expect = 2e-45 Identities = 106/323 (32%), Positives = 166/323 (51%), Gaps = 14/323 (4%) Query: 21 EVDVPKPGPGEVLIKILATSICGTDLHIYEWNEWAQTRIRPPQIMGHEVAGEVVEVGPGV 80 EVD P+PGPGEV +++ A ICG+DL Y + +R P ++GHEVAGE+ +G GV Sbjct: 16 EVDPPEPGPGEVRVRVRAGGICGSDLSYYFKGKSGDFAVREPFVLGHEVAGEIDSLGEGV 75 Query: 81 EG---IEVGDYVSVETHIVCGKCYACKRGQYHVCQNTKIFG-----VDTDGVFAEYAVVP 132 + G V+V + CG C C G + C N + G T G+F +Y VV Sbjct: 76 TAERRLAPGQRVAVNPGLACGTCRFCVGGMPNHCLNMRFMGSASTFPHTQGMFRQYIVVA 135 Query: 133 AQNVWKNPKNIPPEYATLQEPLGNAVDTV-LAGPIAGKSVLITGAGPLGLLGIAVAKASG 191 A+ P + A++ EPL A+ V AG + G SVL+ G GP+G + ++VA+ +G Sbjct: 136 ARQCVPVPDGVDFAQASMAEPLAVALHAVKQAGSLVGASVLLVGCGPIGCILLSVARRAG 195 Query: 192 AYPVIVSEPSEFRRNLAKKVGADYVINPFEEDVVKEVMDITDGNGVDVFLEFSGAPKALE 251 A+ V+ + S+ +A+++GAD +N E V+ + + G DV +E SG+P L+ Sbjct: 196 AHRVVALDLSDRALQVARQLGADQTVNAAERAVIDQ-WSVQRGT-FDVVIEASGSPAGLD 253 Query: 252 QGLQAVTPAGRVSLLGLFPGKVSIDFNNLIIFKALTVYGITGRHLWETWYTVSRLLQSGK 311 L A G V +G P S NL++ K L G + + + SGK Sbjct: 254 TALHAARAGGTVIQVGNLPAGQSPVAANLVMSKELRYQG--SFRFTSEYAIAADEIASGK 311 Query: 312 LNIDPIITHKYKGFDKYEEAFEL 334 +++ P++TH + + AFE+ Sbjct: 312 VDLRPLMTHAF-AMSEANRAFEV 333 Lambda K H 0.318 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 16 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 348 Length adjustment: 29 Effective length of query: 319 Effective length of database: 319 Effective search space: 101761 Effective search space used: 101761 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory