Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate BPHYT_RS34650 BPHYT_RS34650 l-threonine 3-dehydrogenase
Query= BRENDA::P07913 (341 letters) >FitnessBrowser__BFirm:BPHYT_RS34650 Length = 343 Score = 559 bits (1441), Expect = e-164 Identities = 262/340 (77%), Positives = 302/340 (88%) Query: 1 MKALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV 60 MKAL+KL+ G+ +TDV PE+GHND++I+I +TAICGTD+HI+ WD+W+QKTIPVPM Sbjct: 1 MKALAKLERAPGLTLTDVKKPEVGHNDVMIRITRTAICGTDIHIWKWDDWAQKTIPVPMH 60 Query: 61 VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGC 120 VGHEYVGE+V +GQEV+GF IGDRVSGEGHITCG CRNCR GR HLCRNT+GVGVNR G Sbjct: 61 VGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGA 120 Query: 121 FAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA 180 FAEYLVIPAFNAFKIP ISDDLAAIFDPFGNA HTALSF+LVGEDVL++GAGPIGIMA Sbjct: 121 FAEYLVIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNLVGEDVLITGAGPIGIMAV 180 Query: 181 AVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMS 240 A+AKHVGARNVVITDVN+YRLELARKMG TRAVNV++E+L DVMA+L MTEGFDVGLEMS Sbjct: 181 AIAKHVGARNVVITDVNDYRLELARKMGATRAVNVSRESLRDVMADLHMTEGFDVGLEMS 240 Query: 241 GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA 300 G P AF +ML+ MNHGG+IA+LGIPP+ +IDWT+VIFKGL IKGIYGREMFETWYKM A Sbjct: 241 GVPSAFTSMLEAMNHGGKIALLGIPPAQTAIDWTQVIFKGLEIKGIYGREMFETWYKMVA 300 Query: 301 LIQSGLDLSPIITHRFSIDDFQKGFDAMRSGQSGKVILSW 340 ++QSGLDLSPI+TH F +DD+Q+ F M SG+SGKVIL W Sbjct: 301 MLQSGLDLSPILTHHFKVDDYQEAFATMLSGESGKVILDW 340 Lambda K H 0.322 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 524 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 343 Length adjustment: 29 Effective length of query: 312 Effective length of database: 314 Effective search space: 97968 Effective search space used: 97968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS34650 BPHYT_RS34650 (l-threonine 3-dehydrogenase)
to HMM TIGR00692 (tdh: L-threonine 3-dehydrogenase (EC 1.1.1.103))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00692.hmm # target sequence database: /tmp/gapView.10834.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00692 [M=340] Accession: TIGR00692 Description: tdh: L-threonine 3-dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-167 542.2 0.4 2.5e-167 542.1 0.4 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS34650 BPHYT_RS34650 l-threonine 3-dehy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS34650 BPHYT_RS34650 l-threonine 3-dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 542.1 0.4 2.5e-167 2.5e-167 1 340 [] 3 340 .. 3 340 .. 0.99 Alignments for each domain: == domain 1 score: 542.1 bits; conditional E-value: 2.5e-167 TIGR00692 1 almkkkaeeGavltevpvpelgknevlikvkatsicGtdvhiynwdewaqkrikvpqvlGhevaGevvgi 70 al+k++ + G +lt+v+ pe+g+n+v+i++ +t+icGtd+hi++wd+waqk+i+vp+ +Ghe++Ge+v++ lcl|FitnessBrowser__BFirm:BPHYT_RS34650 3 ALAKLERAPGLTLTDVKKPEVGHNDVMIRITRTAICGTDIHIWKWDDWAQKTIPVPMHVGHEYVGEIVEM 72 7999****************************************************************** PP TIGR00692 71 GeevegvkvGdyvsaethivcGkcvacrrGkshvcrntkivGvdtaGvfaeyvvvpadnifknpkdidpe 140 G+ev+g+ +Gd+vs+e+hi+cG c++cr+G+ h+crnt++vGv+++G+faey+v+pa+n+fk+p +i+++ lcl|FitnessBrowser__BFirm:BPHYT_RS34650 73 GQEVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLVIPAFNAFKIPPEISDD 142 ********************************************************************** PP TIGR00692 141 laaiqeplGnavdtvlesdlaGesvlvsGaGpiGllavavakaaGasqvivsdkneyrlelakkvGatrv 210 laai++p+Gna +t+l+++l+Ge+vl++GaGpiG++ava+ak++Ga++v+++d+n+yrlela+k+Gatr+ lcl|FitnessBrowser__BFirm:BPHYT_RS34650 143 LAAIFDPFGNATHTALSFNLVGEDVLITGAGPIGIMAVAIAKHVGARNVVITDVNDYRLELARKMGATRA 212 ********************************************************************** PP TIGR00692 211 vnvakedlvkvvaeltsgeGvdvvlelsGapkaleqgldavangGrvallglpeskvtidltnkvifkgl 280 vnv +e l +v+a+l ++eG+dv+le+sG p+a++ +l+a+++gG++allg+p+++ +id+t +vifkgl lcl|FitnessBrowser__BFirm:BPHYT_RS34650 213 VNVSRESLRDVMADLHMTEGFDVGLEMSGVPSAFTSMLEAMNHGGKIALLGIPPAQTAIDWT-QVIFKGL 281 **************************************************************.9****** PP TIGR00692 281 tikGitGrklfetwykvsrliqsnkldlapiithkfkldefekgfelmrsGksGkvilil 340 ikGi+Gr++fetwyk+ +++qs +ldl+pi+th+fk+d+++++f m sG+sGkvil + lcl|FitnessBrowser__BFirm:BPHYT_RS34650 282 EIKGIYGREMFETWYKMVAMLQS-GLDLSPILTHHFKVDDYQEAFATMLSGESGKVILDW 340 ***********************.9********************************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (343 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.89 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory