Align gluconolactonase subunit (EC 3.1.1.17) (characterized)
to candidate BPHYT_RS21245 BPHYT_RS21245 gluconolactonase
Query= metacyc::MONOMER-13276 (356 letters) >FitnessBrowser__BFirm:BPHYT_RS21245 Length = 313 Score = 138 bits (348), Expect = 2e-37 Identities = 99/319 (31%), Positives = 156/319 (48%), Gaps = 32/319 (10%) Query: 48 ITKFSPRLDAILDVSTPIEVIASDIQWSEGPVWVKNGNFLLFSDPPANIMRKW-TPDAGV 106 I F PR ++ S +E + +WSEGPVW +G +LL+SD P + + +W P V Sbjct: 13 IRVFDPRFKPLILASASVECLYQGARWSEGPVWFGDGRYLLWSDIPNDRILRWDEPSGTV 72 Query: 107 SIFLKPSGHAEPIPAGQFREPGSNGMKVGPDGKIWVADSGTRAIMKVDPVTRQRSVVVDN 166 S F + S +A NG G++ + TR + + + +V+ + Sbjct: 73 STFRQSSNNA-------------NGHTRDRQGRLVSCEHLTRRVTRTE-YDGSITVLAER 118 Query: 167 YKGKRFNSPNDLFFSKSGAVYFTDPPYGLTNLDESDIKEMNYNG-VFRL-SPDGRLDLIE 224 Y+GKRFNSPND+ G+++F+DP +G+ E + +E V+R+ G + ++ Sbjct: 119 YRGKRFNSPNDVVVKSDGSIWFSDPTFGIDGFYEGERQESELPACVYRIDGQSGEVTVVA 178 Query: 225 AGLSRPNGLALSPDETKLYVSNSDRASPNIWVYSLDSNGLPTSRTLLRNFRKEYFDQGLA 284 + PNGLA SPDE+ LY+ S R P+ + + D G T L N + D G Sbjct: 179 DDVLGPNGLAFSPDESVLYIVES-RGEPHRTIRAFDVEG--TGGALSNN--RVLIDAG-P 232 Query: 285 GLPDGMNIDKQGNLF------ASAPGGIYIFAPDGECLGLISGNPGQPLSNCCFGEKGQT 338 G PDG +D GNL+ G+ +F GE LG I+ + +N CFG + + Sbjct: 233 GTPDGFRVDVHGNLWCGWGMGTDELDGVRVFTSQGEPLGHIA--LPERCANVCFGGRHRN 290 Query: 339 -LFISASHNVVRVRTKTFG 356 LF++ASH + + T G Sbjct: 291 RLFMAASHGLYSLYVNTQG 309 Lambda K H 0.317 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 313 Length adjustment: 28 Effective length of query: 328 Effective length of database: 285 Effective search space: 93480 Effective search space used: 93480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory