GapMind for catabolism of small carbon sources

 

Alignments for a candidate for lacB in Burkholderia phytofirmans PsJN

Align predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (characterized)
to candidate BPHYT_RS01960 BPHYT_RS01960 cytochrome C

Query= reanno::Cola:Echvi_1841
         (141 letters)



>FitnessBrowser__BFirm:BPHYT_RS01960
          Length = 115

 Score = 76.3 bits (186), Expect = 1e-19
 Identities = 31/82 (37%), Positives = 52/82 (63%)

Query: 56  DYVEGLALVKESDCPSCHMVERKIVGPAYKDVAEKYESTDENIETLAKRVVDGNNGVWGQ 115
           D   G  +   + C  CH V+RK+VGP+++ +A KY+   +    L+++V DG +GVWG 
Sbjct: 28  DAPRGQLVANANACMGCHAVDRKLVGPSFQQIAGKYKGDAQAPAKLSRKVKDGGSGVWGM 87

Query: 116 VPMPAHPGLSEDDAKKMVKYIL 137
           +PMPAH  +S+ D + +V ++L
Sbjct: 88  IPMPAHQSMSDADIRAVVDWVL 109


Lambda     K      H
   0.309    0.127    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 43
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 141
Length of database: 115
Length adjustment: 14
Effective length of query: 127
Effective length of database: 101
Effective search space:    12827
Effective search space used:    12827
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.3 bits)
S2: 41 (20.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory