Align MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)
to candidate BPHYT_RS22760 BPHYT_RS22760 sugar ABC transporter ATP-binding protein
Query= TCDB::Q00752 (377 letters) >FitnessBrowser__BFirm:BPHYT_RS22760 Length = 384 Score = 302 bits (773), Expect = 1e-86 Identities = 177/383 (46%), Positives = 238/383 (62%), Gaps = 17/383 (4%) Query: 1 MVELNLNHIYKKYPNSSHYSVEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKG 60 M ++L + K Y + + D DL+I EF VF+GPSGCGKST LRM+AGLED+T G Sbjct: 1 MASISLRGVQKAYGEGAPV-IRDVDLEIGENEFCVFLGPSGCGKSTLLRMIAGLEDLTDG 59 Query: 61 ELKIDGEVVNDKAPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAA 120 +L I G+++ND R +AMVFQ+YAL+PHMSV++NMAFGLKL K+ +D++V+EAA Sbjct: 60 DLSIGGKLMNDVPAAQRGVAMVFQSYALFPHMSVFENMAFGLKLAKTPKDEVDRKVREAA 119 Query: 121 QILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAK 180 +IL L LERKP LSGGQRQRVA+GRAIVR+ VFL DEPLSNLDA LR R EIA+ Sbjct: 120 RILQLEALLERKPKALSGGQRQRVAIGRAIVREPGVFLFDEPLSNLDATLRGQTRIEIAR 179 Query: 181 IHRRIG-ATTIYVTHDQTEAMTLADRIVIMSSTKNEDGSGTIGRVEQVGTPQELYNRPAN 239 +H++ A+ +YVTHDQ EAMTLAD+IV++ + K+ + G+I Q+G P ELY+RP + Sbjct: 180 LHKQFAKASVVYVTHDQIEAMTLADKIVLLHAGKDTERYGSIA---QIGAPLELYHRPKS 236 Query: 240 KFVAGFIGSPAMNFFDVTIKDGHLVSKD--GLTIAVTEGQLKM---LESKGFKNKNLI-F 293 +FVAGFIGSP MNF G + S D G+TI + Q + + G + + Sbjct: 237 RFVAGFIGSPRMNFL-----PGRVASLDAQGVTITLDHTQETVRVPVNGAGLQTSQAVTL 291 Query: 294 GIRPEDISSSLLVQETYPDATVDAEVVVSELLGSETMLYL-KLGQTEFAARVDARDFHEP 352 G+RPE + DA + V + E LG + ++L + G A+ P Sbjct: 292 GVRPEHLEFVDPSSVAPDDAVLTRTVSLVEQLGEHSYVHLDQPGGAALVAKAPGNTRLAP 351 Query: 353 GEKVSLTFNVAKGHFFDAETEAA 375 GE+ SL A H F + AA Sbjct: 352 GERASLRVPRAACHLFTEDGFAA 374 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 384 Length adjustment: 30 Effective length of query: 347 Effective length of database: 354 Effective search space: 122838 Effective search space used: 122838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory