Align ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized)
to candidate BPHYT_RS27970 BPHYT_RS27970 sugar ABC transporter permease
Query= TCDB::G4FGN6 (278 letters) >FitnessBrowser__BFirm:BPHYT_RS27970 Length = 317 Score = 134 bits (337), Expect = 3e-36 Identities = 81/296 (27%), Positives = 145/296 (48%), Gaps = 37/296 (12%) Query: 15 VVLILIWCVFPLYWAFISSIKPDRDLFEKNPSLFPKRITFENYVKVF----KERPFHI-- 68 V+ + P+ W F++S K D P + + + E YV +F ++ P I Sbjct: 25 VITYALLATLPMVWIFLTSFKTQEDAIAYPPVVLFQP-SMEGYVNLFTIRSRQTPEFIAS 83 Query: 69 ---------------------------NIKNSIIVAGITTVLALVVGSLAGYAIARLKFR 101 NS+++ +T LA+ +G+LA YA +R K Sbjct: 84 LPPARTWYERDVRKRNMVIAGPSKVLPRFANSLVIGFGSTFLAVFLGTLAAYAFSRFKVP 143 Query: 102 GKVIVMSLILAVSMFPQVSILGSLFLILRGLKLINTYTGLIIPYTAMNLPLTVWVLQSFF 161 ++ IL+ M P +++ ++L+ R L L ++ G+I+ YTA+N+ L VW+L+ F Sbjct: 144 LADDLLFFILSTRMMPPIAVAIPIYLMYRALGLSDSCVGMIVLYTAVNVSLAVWLLKGFM 203 Query: 162 RELPKEVEESAFIDGASKLRTLWSIVLPMSAPGLVATGLLTFIAAWNEFLFALTFMQKPS 221 E+P+E EE+A +DG ++L+ +VLP + G+ AT + I AWNE+ FA + + Sbjct: 204 DEIPREYEEAALVDGYTRLQAFVKVVLPQAITGIAATAIFCLIFAWNEYAFA-SLLTSGD 262 Query: 222 LYTVPVAVALFKGASQYEIPWGQLMAAAVIVTLPLVILVLVFQNRIIAGLSAGAVK 277 T+P + G + W + AA + LP++I +V + ++ G++ GAV+ Sbjct: 263 AQTMPPFIPFIIGEGGQD--WPAVAAATTLFVLPILIFTVVLRKHLLRGITFGAVR 316 Lambda K H 0.329 0.142 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 317 Length adjustment: 26 Effective length of query: 252 Effective length of database: 291 Effective search space: 73332 Effective search space used: 73332 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory