Align Maltose transport system permease protein malG aka TT_C1629, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate BPHYT_RS35660 BPHYT_RS35660 membrane protein
Query= TCDB::Q72H66 (280 letters) >FitnessBrowser__BFirm:BPHYT_RS35660 Length = 283 Score = 154 bits (390), Expect = 2e-42 Identities = 89/274 (32%), Positives = 150/274 (54%), Gaps = 6/274 (2%) Query: 11 LFFYLLVVFVVVYSVFPFYWAVISSFKPSDALFSPDPSFLPVPFTLEHYENVFLQANFGR 70 L+ +L + +VV +FPF + ++ KP+ +F +LPV + ++ ++++ ANFG Sbjct: 11 LWCWLALSPLVVVVLFPFAVMLFTALKPASEIFVYPARWLPVHWQWSNFSDMWVAANFGV 70 Query: 71 NLLNSLIVAGGATLLSLVLGVLAAYALGRLPFPPKNAVMYIVLSMTMFPQIAVLGGLFLL 130 L NS +++ +T L+L + + AAYAL R PF + +L M I ++ GLF L Sbjct: 71 ALRNSTVISLLSTALALAVSLPAAYALARFPFRGRGLYRQFLLVTQMLSPILLVVGLFRL 130 Query: 131 LRQT-----GLFNTHLGLILTYLLFTLPFTVWVLVGYFRGLPRELEEAAYVDGATPLQTL 185 L ++ +G+I++Y F + F VW+L YF+ +PR+LEE+A+++G + + Sbjct: 131 AAMIPYGDGNLVDSKIGVIVSYAAFNIAFAVWMLSSYFQTVPRDLEESAWLEGCGRTKAV 190 Query: 186 LKVMLPLTGPGLVTTGLLAFIAAWNEYLFALTFTVGDSVKTVPPAIASFGGATPFEIPWG 245 KV LPL P +V T + FI AWNE+ T KT+ + A + + W Sbjct: 191 FKVFLPLAVPAIVVTAIFTFINAWNEFAVVYTLIRSPENKTLTVQVTDM-VAGKYVVQWH 249 Query: 246 SIMAASVVVTVPLVVLVLVFQQRIVAGLTAGAVK 279 +MAA++ T+P+ V+ Q+ +V GL GAVK Sbjct: 250 LVMAATLCATLPVSVVFAWLQRYLVKGLALGAVK 283 Lambda K H 0.329 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 283 Length adjustment: 26 Effective length of query: 254 Effective length of database: 257 Effective search space: 65278 Effective search space used: 65278 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory