Align catechol 1,2-dioxygenase 2; EC 1.13.11.1 (characterized)
to candidate BPHYT_RS10670 BPHYT_RS10670 catechol 1,2-dioxygenase
Query= CharProtDB::CH_014953 (275 letters) >FitnessBrowser__BFirm:BPHYT_RS10670 Length = 302 Score = 515 bits (1327), Expect = e-151 Identities = 249/261 (95%), Positives = 257/261 (98%) Query: 1 MNKQAIDALLQKINDSAINEGNPRTKQIVNRIVRDLFYTIEDLDVQPDEFWTALNYLGDA 60 MNKQAIDALL KINDSA +EGNPRTKQIVNRIV+DLFYTIEDLDVQP EFWTALNYLGDA Sbjct: 1 MNKQAIDALLNKINDSATSEGNPRTKQIVNRIVQDLFYTIEDLDVQPAEFWTALNYLGDA 60 Query: 61 GRSGELGLLAAGLGFEHFLDLRMDEAEAKAGVEGGTPRTIEGPLYVAGAPVSDGHARLDD 120 G+SGELGLLAAGLGFEHFLDLR+DEAEAKAG+EGGTPRTIEGPLYVAGAP+SDGHARLDD Sbjct: 61 GKSGELGLLAAGLGFEHFLDLRLDEAEAKAGIEGGTPRTIEGPLYVAGAPLSDGHARLDD 120 Query: 121 GTDPGQTLVMRGRVFGEDGKPLANALVEVWHANHLGNYSYFDKSQPAFNLRRSIRTDAEG 180 GTDPGQTLVMRGRV GEDGKPLA+ALVEVWHANHLGNYSYFDKSQPAFNLRRSIRTDAEG Sbjct: 121 GTDPGQTLVMRGRVLGEDGKPLAHALVEVWHANHLGNYSYFDKSQPAFNLRRSIRTDAEG 180 Query: 181 KYSFRSVVPVGYSVPPQGQTQLLLDQLGRHGHRPAHIHFFVSAPGFRKLTTQINIDGDPY 240 KYSFRSVVPVGYSVPPQGQTQLLLDQLGRHGHRPAHIHFFVSAPGFRKLTTQINIDGDPY Sbjct: 181 KYSFRSVVPVGYSVPPQGQTQLLLDQLGRHGHRPAHIHFFVSAPGFRKLTTQINIDGDPY 240 Query: 241 LWDDFAFATRDGLVPAVRQAE 261 LWDDFAFATRDGLVPAV+QAE Sbjct: 241 LWDDFAFATRDGLVPAVKQAE 261 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 302 Length adjustment: 26 Effective length of query: 249 Effective length of database: 276 Effective search space: 68724 Effective search space used: 68724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate BPHYT_RS10670 BPHYT_RS10670 (catechol 1,2-dioxygenase)
to HMM TIGR02439 (catA: catechol 1,2-dioxygenase (EC 1.13.11.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02439.hmm # target sequence database: /tmp/gapView.1327.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02439 [M=285] Accession: TIGR02439 Description: catechol_proteo: catechol 1,2-dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-144 466.0 0.0 2e-144 465.8 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS10670 BPHYT_RS10670 catechol 1,2-dioxy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS10670 BPHYT_RS10670 catechol 1,2-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 465.8 0.0 2e-144 2e-144 2 285 .] 3 283 .. 2 283 .. 0.99 Alignments for each domain: == domain 1 score: 465.8 bits; conditional E-value: 2e-144 TIGR02439 2 tkevqallkkvagleqeggnarikqivlrvlsdlfkaiedlditedefwaaveylnklGqanelgllaaG 71 ++ ++all+k++ +++gn+r+kqiv+r+++dlf +iedld+++ efw+a++yl+++G+++elgllaaG lcl|FitnessBrowser__BFirm:BPHYT_RS10670 3 KQAIDALLNKINDSATSEGNPRTKQIVNRIVQDLFYTIEDLDVQPAEFWTALNYLGDAGKSGELGLLAAG 72 689******************************************************************* PP TIGR02439 72 lGlehfldlrldaadakagleggtPrtieGPlyvaGapvseGfarlddgseddkaetlvlkGqvldaeGk 141 lG+ehfldlrld+a+akag+eggtPrtieGPlyvaGap+s+G+arlddg+ d ++tlv++G+vl ++Gk lcl|FitnessBrowser__BFirm:BPHYT_RS10670 73 LGFEHFLDLRLDEAEAKAGIEGGTPRTIEGPLYVAGAPLSDGHARLDDGT--DPGQTLVMRGRVLGEDGK 140 **************************************************..668*************** PP TIGR02439 142 piagakvevwhanskGnysffdksqsefnlrrtiitdaeGkyrarsvvPvGygvppqgptqqllnllGrh 211 p+a a vevwhan+ Gnys+fdksq fnlrr+i+tdaeGky++rsvvPvGy+vppqg+tq ll++lGrh lcl|FitnessBrowser__BFirm:BPHYT_RS10670 141 PLAHALVEVWHANHLGNYSYFDKSQPAFNLRRSIRTDAEGKYSFRSVVPVGYSVPPQGQTQLLLDQLGRH 210 ********************************************************************** PP TIGR02439 212 GerPahvhffvsapgyrklttqinlegdkylyddfafatreglvaevkevedaaaakrrgvegrfaeief 281 G+rPah+hffvsapg+rklttqin++gd+yl+ddfafatr+glv++vk+ e+a+ + +gv+g+fa i+f lcl|FitnessBrowser__BFirm:BPHYT_RS10670 211 GHRPAHIHFFVSAPGFRKLTTQINIDGDPYLWDDFAFATRDGLVPAVKQAEGAEGKP-YGVDGNFALIDF 279 ***************************************************999988.************ PP TIGR02439 282 dlel 285 d++l lcl|FitnessBrowser__BFirm:BPHYT_RS10670 280 DFTL 283 **87 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (302 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.64 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory