Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate BPHYT_RS05495 BPHYT_RS05495 histidine ABC transporter ATP-binding protein
Query= uniprot:P70970 (276 letters) >FitnessBrowser__BFirm:BPHYT_RS05495 Length = 259 Score = 133 bits (335), Expect = 3e-36 Identities = 82/223 (36%), Positives = 132/223 (59%), Gaps = 14/223 (6%) Query: 10 LYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVI--QAGKKN--- 64 L ++ G ++VIG +GSGKST+L+ +N L +P G+I + + Q GK Sbjct: 23 LKGVSLKANAGDVISVIGSSGSGKSTMLRCINFLEQPNSGRIFVDGEEVRTQIGKNGALR 82 Query: 65 ----KDLKKLRKKVGIVFQFPEHQLFEE-TVLKDISFGPMN-FGVKKEDAEQKAREMLQL 118 K L+++R ++ +VFQ L+ VL++I P+N G+K+++AE +ARE L+ Sbjct: 83 VSDPKQLQRVRTRLSMVFQ--HFNLWSHMNVLENIIEAPVNVLGLKRKEAEDRAREYLEK 140 Query: 119 VGLSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYEL 178 VGL+ L + P LSGGQ +RVAIA LAM P+V++ DEPT+ LDP E++ + L Sbjct: 141 VGLAPRLEKQYPSHLSGGQQQRVAIARALAMHPDVMLFDEPTSALDPELVGEVLKVMQTL 200 Query: 179 HQRGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLF 221 + G T I+VTH M A ++ ++ +H+G ++ G P ++F Sbjct: 201 AEEGR-TMIVVTHEMAFARNVSNHVMFLHQGRVEEEGHPDEVF 242 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 259 Length adjustment: 25 Effective length of query: 251 Effective length of database: 234 Effective search space: 58734 Effective search space used: 58734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory