Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate BPHYT_RS13580 BPHYT_RS13580 arginine ABC transporter ATP-binding protein
Query= uniprot:P70970 (276 letters) >FitnessBrowser__BFirm:BPHYT_RS13580 Length = 248 Score = 136 bits (342), Expect = 5e-37 Identities = 86/216 (39%), Positives = 131/216 (60%), Gaps = 12/216 (5%) Query: 10 LYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLKK 69 L ++ +++ G V +IG +GSGKSTLL+ +NGL + G+I++ + A K+K + + Sbjct: 17 LKGVSLNVERGQVVCLIGPSGSGKSTLLRCINGLERHDAGEITVEGRTVDA--KSKQIHE 74 Query: 70 LRKKVGIVFQFPEHQLF-EETVLKDISFGPMNFGVKKE---DAEQKAREMLQLVGLSEEL 125 LR +VG+VFQ LF T L+++ GP+ VKK+ A ++AR +L VGL+ + Sbjct: 75 LRAQVGMVFQ--RFNLFPHRTALENVFEGPVF--VKKQARAQARERARHLLDKVGLAHRM 130 Query: 126 LDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLT 185 + P ELSGGQ +RVAIA LAM+P+ ++ DEPT+ LDP E++ + +L G +T Sbjct: 131 -NAHPAELSGGQQQRVAIARALAMEPKAILFDEPTSALDPELVGEVLGVMRQLADDG-MT 188 Query: 186 TILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLF 221 I+VTH M A AD + +H G I GS +LF Sbjct: 189 MIVVTHEMAFAREVADRVCFLHDGAIHEEGSAAELF 224 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 248 Length adjustment: 25 Effective length of query: 251 Effective length of database: 223 Effective search space: 55973 Effective search space used: 55973 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory