Align Tryptophan 2,3-dioxygenase; TDO; Tryptamin 2,3-dioxygenase; Tryptophan oxygenase; TO; TRPO; Tryptophan pyrrolase; Tryptophanase; EC 1.13.11.11 (characterized)
to candidate BPHYT_RS16035 BPHYT_RS16035 tryptophan 2,3-dioxygenase
Query= SwissProt::Q1LK00 (299 letters) >FitnessBrowser__BFirm:BPHYT_RS16035 Length = 310 Score = 448 bits (1153), Expect = e-131 Identities = 212/295 (71%), Positives = 246/295 (83%), Gaps = 1/295 (0%) Query: 5 KGCPMGHGAAPQNGDGGDSGDTGNGWHGAQMDFARDMSYGDYLGLDQILSAQHPLSPDHN 64 +GCP GHGA + + D+G+GWH AQ+DF+ MSYGDYL L +L AQHPLSPDHN Sbjct: 17 QGCPFGHGAVASSV-ATPAADSGDGWHDAQLDFSESMSYGDYLSLGTVLDAQHPLSPDHN 75 Query: 65 EMLFIVQHQTTELWMKLMLHELRAARDGVKSDQLQPAFKMLARVSRIMDQLVQAWNVLAT 124 EMLFI+QHQT+ELWMKL L+ELRAA V D+L PAFKMLARVSRIM+QLVQAW+VLAT Sbjct: 76 EMLFIIQHQTSELWMKLALYELRAALQAVHRDELPPAFKMLARVSRIMEQLVQAWSVLAT 135 Query: 125 MTPPEYSAMRPYLGASSGFQSYQYREIEFILGNKNAAMLRPHAHRPEHLELVETALHTPS 184 MTP EY+AMRPYLG+SSGFQSYQYR+IEF+LGNKN ML+PHAHR + L V+ +L PS Sbjct: 136 MTPSEYTAMRPYLGSSSGFQSYQYRQIEFLLGNKNEQMLKPHAHRADVLAEVKASLEAPS 195 Query: 185 MYDEAIRLMARRGFQIDPEVVERDWTQPTQYNASVEAAWLEVYRNPSAHWELYELGEKFV 244 YDE +RL+ARRGF I +ERDWTQPT ++ASVEAAWLEVYRNPS HWELYE+ E+ V Sbjct: 196 FYDEVVRLLARRGFAISAARLERDWTQPTVHDASVEAAWLEVYRNPSQHWELYEMAEELV 255 Query: 245 DLEDAFRQWRFRHVTTVERVIGFKRGTGGTEGVSYLRRMLDVVLFPELWKLRTDL 299 DLEDAFRQWRFRHVTTVER+IGFK+GTGGT G +YLR+MLDVVLFPELW +RT L Sbjct: 256 DLEDAFRQWRFRHVTTVERIIGFKQGTGGTSGATYLRKMLDVVLFPELWHVRTML 310 Lambda K H 0.321 0.136 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 310 Length adjustment: 27 Effective length of query: 272 Effective length of database: 283 Effective search space: 76976 Effective search space used: 76976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate BPHYT_RS16035 BPHYT_RS16035 (tryptophan 2,3-dioxygenase)
to HMM TIGR03036 (kynA: tryptophan 2,3-dioxygenase (EC 1.13.11.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03036.hmm # target sequence database: /tmp/gapView.32110.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03036 [M=264] Accession: TIGR03036 Description: trp_2_3_diox: tryptophan 2,3-dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-138 444.8 1.7 5.7e-138 444.6 1.7 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS16035 BPHYT_RS16035 tryptophan 2,3-dio Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS16035 BPHYT_RS16035 tryptophan 2,3-dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.6 1.7 5.7e-138 5.7e-138 1 264 [] 47 310 .] 47 310 .] 1.00 Alignments for each domain: == domain 1 score: 444.6 bits; conditional E-value: 5.7e-138 TIGR03036 1 dfsesmsYgdYlkldellsaqkplsedhdemlfivqhqvselwlklilheleaaaralradeleaalkal 70 dfsesmsYgdYl+l ++l+aq+pls+dh+emlfi+qhq+selw+kl+l+el+aa +a+++del++a+k+l lcl|FitnessBrowser__BFirm:BPHYT_RS16035 47 DFSESMSYGDYLSLGTVLDAQHPLSPDHNEMLFIIQHQTSELWMKLALYELRAALQAVHRDELPPAFKML 116 8********************************************************************* PP TIGR03036 71 aRvsrileqlveaWdvLatltPaeysefRealgessGfqsyqyReiefllGnknaallkphekdpellae 140 aRvsri+eqlv+aW+vLat+tP+ey+++R++lg+ssGfqsyqyR+iefllGnkn+++lkph++++++lae lcl|FitnessBrowser__BFirm:BPHYT_RS16035 117 ARVSRIMEQLVQAWSVLATMTPSEYTAMRPYLGSSSGFQSYQYRQIEFLLGNKNEQMLKPHAHRADVLAE 186 ********************************************************************** PP TIGR03036 141 leaaleePslYdevlrllarrGfaipaevlerdvtkpaeaneeveaawlevYrdaekewelyelaeklvD 210 ++a+le+Ps+Ydev+rllarrGfai a++lerd+t+p+ ++++veaawlevYr+++++welye+ae+lvD lcl|FitnessBrowser__BFirm:BPHYT_RS16035 187 VKASLEAPSFYDEVVRLLARRGFAISAARLERDWTQPTVHDASVEAAWLEVYRNPSQHWELYEMAEELVD 256 ********************************************************************** PP TIGR03036 211 ledlfrrWRfrhlttveRiiGfkrGtGGssGvayLkkaldvelfPelwkvRtel 264 led+fr+WRfrh+ttveRiiGfk+GtGG+sG++yL+k+ldv+lfPelw+vRt l lcl|FitnessBrowser__BFirm:BPHYT_RS16035 257 LEDAFRQWRFRHVTTVERIIGFKQGTGGTSGATYLRKMLDVVLFPELWHVRTML 310 ***************************************************975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (264 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.94 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory