Align 2-oxopent-4-enoate hydratase; 2-keto-4-pentenoate hydratase; EC 4.2.1.80 (characterized)
to candidate BPHYT_RS07240 BPHYT_RS07240 2-keto-4-pentenoate hydratase
Query= SwissProt::Q9KWS4 (261 letters) >FitnessBrowser__BFirm:BPHYT_RS07240 Length = 273 Score = 319 bits (818), Expect = 3e-92 Identities = 166/256 (64%), Positives = 198/256 (77%), Gaps = 4/256 (1%) Query: 7 KLAALLNEAELSEKPIEPVRGHIE--GGIA--QAYAIQQINVQRQLAAGRRVTGRKIGLT 62 ++A L A+ + P+ PVR I GG A AYA+Q++N +RQLAAGRR+ GRKIGLT Sbjct: 11 RIADALWRAQQTGVPVAPVRNAIAELGGDALDAAYAVQRVNTERQLAAGRRLVGRKIGLT 70 Query: 63 SAAVQKQLGVDQPDFGTLFDSMAVNDGEEIAWSRTLQPKCEAEVALVIERDLDHENITLI 122 S AVQ QLGVDQPDFG LFD M++ DGEEIA SRT QPK EAE+ALV+ RDL HE T+ Sbjct: 71 SKAVQTQLGVDQPDFGMLFDDMSIADGEEIALSRTQQPKVEAEIALVLARDLPHERNTIA 130 Query: 123 DLIGATAYALPAIEVVGSRIANWDINILDTVADNASAGLYVLGHTPVKLEGLDLRLAGMV 182 DLIGATAYALPAIE+VGSRIANWDI + DTVADNAS+GL+VLG+ PVKL D+ GM Sbjct: 131 DLIGATAYALPAIEIVGSRIANWDIRLTDTVADNASSGLFVLGNRPVKLGAFDIVHCGMA 190 Query: 183 MERAGQQVSLGVGAACLGHPLNAALWLARTLVKQGTPLKSGDVVLSGALGPLVAANPGDV 242 MER G VS+GVGAACLG+PL AA+WLA T+ + G PLK+GD+VL+GALGP+ A GDV Sbjct: 191 MERRGDPVSVGVGAACLGNPLYAAVWLANTMTRVGAPLKAGDIVLTGALGPMAAVQAGDV 250 Query: 243 FEARIQGLGSVRACFS 258 F A I+GLGSV A F+ Sbjct: 251 FTAHIEGLGSVSASFA 266 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 273 Length adjustment: 25 Effective length of query: 236 Effective length of database: 248 Effective search space: 58528 Effective search space used: 58528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory