Align 3-oxoadipate enol-lactonase (EC 3.1.1.24) (characterized)
to candidate BPHYT_RS02320 BPHYT_RS02320 3-oxoadipate enol-lactonase
Query= BRENDA::Q13KT2 (263 letters) >FitnessBrowser__BFirm:BPHYT_RS02320 Length = 262 Score = 173 bits (438), Expect = 4e-48 Identities = 92/258 (35%), Positives = 135/258 (52%), Gaps = 8/258 (3%) Query: 6 VNGTELHYRIDGERHGNAPWIVLSNSLGTDLSMWAPQVAALSKHFRVLRYDTRGHGHSEA 65 +NG E Y + E G PW+ + LG DLS+W + VLRYD RGHG + A Sbjct: 5 INGIETRYVLSNE--GGGPWLTFIHQLGGDLSVWDQLAGYFRDDYTVLRYDVRGHGKTAA 62 Query: 66 PKGPYTIEQLTGDVLGLMDTLKIARANFCGLSMGGLTGVALAARHADRIERVALCNTAAR 125 P+ I L+ D+ L+D L + G+SMGG+ H R++ + + +++ Sbjct: 63 SSAPFGIADLSHDLATLLDALGAPTTHLVGMSMGGMIAQQFTLDHPTRVDSLTIADSSG- 121 Query: 126 IGSPE----VWVPRAVKARTEGMHALADAVLPRWFTADYMEREPVVLAMIRDVFVHTDKE 181 G+P+ W RA AR +GM +L A L RW T D+ P + IRDV +T E Sbjct: 122 -GTPQEARATWDQRAATARRDGMVSLVPATLSRWLTPDFQAAHPEAVEQIRDVLTNTLSE 180 Query: 182 GYASNCEAIDAADLRPEAPGIKVPALVISGTHDLAATPAQGRELAQAIAGARYVELDASH 241 GYA CEA+ D+R + I+ P L ++G HD PA + +A AI GAR+ LDA+H Sbjct: 181 GYAMACEALRDFDVRSKLGAIRCPTLTVAGRHDTGTPPASTQAIADAIEGARFELLDAAH 240 Query: 242 ISNIERADAFTKTVVDFL 259 ++ IE++ F + FL Sbjct: 241 LAPIEQSHRFAALLETFL 258 Lambda K H 0.320 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 262 Length adjustment: 25 Effective length of query: 238 Effective length of database: 237 Effective search space: 56406 Effective search space used: 56406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory